DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and CG18011

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_610559.1 Gene:CG18011 / 36068 FlyBaseID:FBgn0033491 Length:985 Species:Drosophila melanogaster


Alignment Length:624 Identity:123/624 - (19%)
Similarity:185/624 - (29%) Gaps:251/624 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SYCP-TDVEVAQWQEFVLHIR-------------------NVHSKVRSMEDDFEPVGE---NSTE 62
            |||. ..:|...|:.|..|.:                   |:....:.:....||||.   :..:
  Fly   428 SYCEMCSLEFPSWKRFNFHSQFHLEKHRPRACFVCDYATTNIDELFQHLNYSHEPVGTLFCDLCD 492

  Fly    63 SGHVDPPEEKPQAEESIFQQD-------ESADGACVQL------------HIDAVRSSTNETEES 108
            ....||         |:|.:.       .|...:|.:.            |:.|:..|....|  
  Fly   493 RTFRDP---------SVFMEHNKSHANVSSTTYSCSECMANFESRGRLNGHMRAMHGSVISCE-- 546

  Fly   109 DVSLVTDEEESVQDEDPSEPALDDANLKTTPTYKFHPSFFRRDHRTIKFIEIYKE-HPCLWNPAH 172
                                 |......|..||..|..         |.:.|.|: |.|......
  Fly   547 ---------------------LCSREFATEATYNIHMK---------KHLIIEKDVHVCSTCGLL 581

  Fly   173 SDYKEP-----KKCKEALKRMAIDLEATVSVFLNEMALKLAIKKVHMQFNT---VHKRVV----- 224
            ||.:|.     ...|.|.....||:|.....::.|.......:|..:|.:.   |||..|     
  Fly   582 SDSRETLLAHVNSVKTACFGSKIDVELLRDAYVCEYCSSYFKEKDCLQAHRDSGVHKDGVFLCQP 646

  Fly   225 SGKQKP---------------------QSLAFSIYKLCCFLNASNDEEGATNNEKIKLDFSKKNK 268
            .||:.|                     :.|...:|.:|       |:|..|              
  Fly   647 CGKEFPHMKLYRHHLRNYQQLRSDSTHRRLEICVYYMC-------DQENCT-------------- 690

  Fly   269 LTTDLIEMYANFPQLYDSNHKEFSNMSSRKQAYESMAAEISVPNVDINSDDIFRAIQNLRQWYYK 333
                  |.|.|:..||  .||..::.|:.|||.:|.                    ::.::|   
  Fly   691 ------ESYVNWNSLY--THKRRTHESASKQAEKSS--------------------KSAQEW--- 724

  Fly   334 NTKHAIYAGSTAEKFYLEVCRFMPAKMYKQRLVCEFCHQITSSDHVLQSHIFKAHNIGELPFKCT 398
                                            ||:||.:...|...|..|:.::||...:  .|.
  Fly   725 --------------------------------VCQFCLKECRSKMSLSVHVARSHNNDNV--TCP 755

  Fly   399 LCDRSFVGRCELANHIQRVHIGKTHKCTHCERSFAVMSDLQLHIRTHT-GHKPYVCEHCGKAFRL 462
            ||:.|:.....||.|                               |. .|:|..|..|.|..:.
  Fly   756 LCNSSYKSHDALAKH-------------------------------HAYWHEPIECPECFKIVKN 789

  Fly   463 RSQMTLHVTAIHTKIRAFKCTMCPKDFVKKVDLSDHIKGHLNIRDKICSVC-----GKGFTSCHA 522
            |.....||..:|:..:.:.|::|.|.|..|.::..|.|  |:.:...|..|     .|...|.|.
  Fly   790 RRNYDTHVNVVHSNKKRYSCSVCQKGFYHKSEMEAHQK--LHGQSYSCEQCSFTTRNKKSLSVHV 852

  Fly   523 LIRHRQIHSEVKKFV--CKLCDSRFSQFVGLNTHMKRTH 559
            |.:|      .|:|.  |.:|..||.:..||.|||:|.|
  Fly   853 LGQH------YKRFAFECNVCKKRFGRSQGLKTHMQRAH 885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916 25/121 (21%)
MADF_DNA_bdg 273..356 CDD:287510 13/82 (16%)
C2H2 Zn finger 367..388 CDD:275368 6/20 (30%)
C2H2 Zn finger 397..418 CDD:275368 7/20 (35%)
COG5048 <423..554 CDD:227381 33/138 (24%)
C2H2 Zn finger 425..445 CDD:275368 0/19 (0%)
zf-H2C2_2 437..460 CDD:290200 6/23 (26%)
C2H2 Zn finger 453..470 CDD:275368 4/16 (25%)
C2H2 Zn finger 482..502 CDD:275368 7/19 (37%)
C2H2 Zn finger 510..530 CDD:275368 7/24 (29%)
C2H2 Zn finger 538..559 CDD:275368 10/20 (50%)
CG18011NP_610559.1 PRK14950 <98..>184 CDD:237864
C2H2 Zn finger 488..508 CDD:275368 4/28 (14%)
C2H2 Zn finger 518..538 CDD:275368 2/19 (11%)
C2H2 Zn finger 545..565 CDD:275368 6/51 (12%)
C2H2 Zn finger 575..596 CDD:275371 4/20 (20%)
SFP1 <682..747 CDD:227516 24/148 (16%)
C2H2 Zn finger 754..775 CDD:275368 8/51 (16%)
C2H2 Zn finger 780..801 CDD:275368 6/20 (30%)
C2H2 Zn finger 809..829 CDD:275368 7/21 (33%)
C2H2 Zn finger 864..885 CDD:275368 10/20 (50%)
C2H2 Zn finger 891..917 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.