DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and CG1603

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster


Alignment Length:596 Identity:193/596 - (32%)
Similarity:301/596 - (50%) Gaps:79/596 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METCGLICVSRDYEKFLMRCSYCPTDVEVAQWQEFVLHIRNVH----SKVRSME----------- 50
            ||.||.:..:..||.|.::|.||..:.|:..|:.|::|:::.|    ..||..|           
  Fly     1 MELCGNVMTNSKYEMFRLKCLYCSIESELKDWELFIVHVKSAHYCEDEDVRINEIKEDTEELYSV 65

  Fly    51 ------------DDFEPVGENSTESGHVDPPEEKPQAEESIFQQDESA---------------DG 88
                        |:|..|.|||      :..::..:|:....|.:|.|               .|
  Fly    66 VDAADPAIAYGPDEFFEVIENS------NGVDQWMEADSKDIQYEEDATAWSAATNNSWEFGPGG 124

  Fly    89 ACVQLHIDAVRSSTNETEESDVSLVTDEEE------SVQDED---PSEPALDDANLKTTPTYKFH 144
            :.::|......:..:|:.::.:.|.||:::      .:.::|   |.:|.......:....:||.
  Fly   125 SSLELPAGKEVTQMDESSQNHIPLNTDDDDVDCSDFFMSEDDLAPPRKPGRPPRRTRPGQVFKFK 189

  Fly   145 PSFFRRDHRTIKFIEIYKEHPCLWNPAHSDYK-EPKKC---KEALKRMAIDLEATVSVFLNEMAL 205
            .||.|.:.|.:..|:.||||||||||:...|: ||.:.   :..::||  |.:|.|...:.|  |
  Fly   190 VSFIRSNPRVLHLIQAYKEHPCLWNPSDEHYQDEPARSMAYEAIMERM--DRKANVLFTVEE--L 250

  Fly   206 KLAIKKVHMQFNTVHKRVVSGKQKPQSLAFSIYKLCCFLNAS---NDEEGATNNE--KIKLDFSK 265
            |..::::|:|:....:....||.  ..||...:..|.||:.:   ...|...:|:  .|||:|.:
  Fly   251 KKTLEQLHVQYTLALETKQRGKL--VGLAARYFAKCEFLSVAPVVTPRENEEDNDLTAIKLNFKE 313

  Fly   266 KNKLTTDLIEMYANFPQLYDSNHKEFSNMSSRKQAYESMAAEISVPNVDINSDDIFRAIQNLRQW 330
            :|.:||..||.|||:|.||:....:|.::..|..|::.||.|.. |.|..|..|::.|:..||:|
  Fly   314 ENLITTSFIETYANYPVLYNQALPDFGSIEIRADAFKRMAKEFQ-PVVKANETDVYIAVNKLRRW 377

  Fly   331 YYK-----NTKHAIYAGSTAEKFYLEVCRFMPAK-MYKQRLVCEFCHQITSSDHVLQSHIFKAHN 389
            .|.     .:|..|...|..|..||::|.|:||| ...|.|.|::|.:....|:.|:.||.|||.
  Fly   378 LYDAIRRLKSKELIQKCSKQEVQYLQMCSFLPAKGSESQVLYCDYCDKRFHGDYNLRVHIVKAHE 442

  Fly   390 IGELPFKCTLCDRSFVGRCELANHIQRVHIGKTHKCTHCERSFAVMSDLQLHIRTHTGHKPYVCE 454
            :|:||:.|:.|.|.|....::..|..|.|..:..||.:||:||||.:||::|...|||.:|:||:
  Fly   443 VGDLPYLCSFCPRRFDRHVDMDRHKLRSHFERKLKCQYCEKSFAVDTDLKVHTLIHTGERPHVCD 507

  Fly   455 HCGKAFRLRSQMTLHVTAIHTKIRAFKCTMCPKDFVKKVDLSDHIKGHLNIRDKICSVCGKGFTS 519
            .|||.|||:..:..||..:|..||.:.|.||.|.|.||.:|::|||||||||||.|..|...|..
  Fly   508 ICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKKCEYCDATFYD 572

  Fly   520 CHALIRHRQIH 530
            ..:|.|||:.|
  Fly   573 HSSLSRHRRSH 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916 29/90 (32%)
MADF_DNA_bdg 273..356 CDD:287510 30/87 (34%)
C2H2 Zn finger 367..388 CDD:275368 7/20 (35%)
C2H2 Zn finger 397..418 CDD:275368 6/20 (30%)
COG5048 <423..554 CDD:227381 55/108 (51%)
C2H2 Zn finger 425..445 CDD:275368 10/19 (53%)
zf-H2C2_2 437..460 CDD:290200 12/22 (55%)
C2H2 Zn finger 453..470 CDD:275368 7/16 (44%)
C2H2 Zn finger 482..502 CDD:275368 11/19 (58%)
C2H2 Zn finger 510..530 CDD:275368 7/19 (37%)
C2H2 Zn finger 538..559 CDD:275368
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510 29/90 (32%)
GT1 321..408 CDD:304916 30/87 (34%)
C2H2 Zn finger 420..441 CDD:275368 7/20 (35%)
COG5048 <424..583 CDD:227381 71/158 (45%)
C2H2 Zn finger 450..471 CDD:275368 6/20 (30%)
C2H2 Zn finger 478..498 CDD:275368 10/19 (53%)
zf-H2C2_2 490..513 CDD:290200 12/22 (55%)
C2H2 Zn finger 506..527 CDD:275368 9/20 (45%)
C2H2 Zn finger 535..555 CDD:275368 11/19 (58%)
C2H2 Zn finger 563..583 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C61I
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I3519
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012671
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.