DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1602 and fezf-1

DIOPT Version :9

Sequence 1:	NP_610291.2	Gene:	CG1602 / 35684	FlyBaseID:	FBgn0033186	Length:	577	Species:	Drosophila melanogaster
Sequence 2:	NP_502594.2	Gene:	fezf-1 / 3564888	WormBaseID:	WBGene00012639	Length:	218	Species:	Caenorhabditis elegans

Alignment Length:	135	Identity:	50/135 - (37%)
Similarity:	67/135 - (49%)	Gaps:	1/135 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   421 KTHKCTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKIRAFKCTMC 485
            |...|..|.:.|....:|..|:..|||.:|:||:.||||||..|.:..| ..|||..:..||..|
Worm    50 KKFPCEICGKQFNAHYNLTRHMPVHTGERPFVCKVCGKAFRQASTLCRH-KIIHTDSKPHKCKTC 113

  Fly   486 PKDFVKKVDLSDHIKGHLNIRDKICSVCGKGFTSCHALIRHRQIHSEVKKFVCKLCDSRFSQFVG 550
            .|.|.:...|:.|::.|...:..:|.:|||||........||..|.:.|||.|.:|...|.|...
Worm   114 GKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRAFHQSYN 178

  Fly   551 LNTHM 555
            |..||
Worm   179 LAFHM 183

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1602	NP_610291.2	GT1	157..244	CDD:304916
		MADF_DNA_bdg	273..356	CDD:287510
		C2H2 Zn finger	367..388	CDD:275368
		C2H2 Zn finger	397..418	CDD:275368
		COG5048	<423..554	CDD:227381	47/130 (36%)
		C2H2 Zn finger	425..445	CDD:275368	5/19 (26%)
		zf-H2C2_2	437..460	CDD:290200	11/22 (50%)
		C2H2 Zn finger	453..470	CDD:275368	8/16 (50%)
		C2H2 Zn finger	482..502	CDD:275368	6/19 (32%)
		C2H2 Zn finger	510..530	CDD:275368	8/19 (42%)
		C2H2 Zn finger	538..559	CDD:275368	7/18 (39%)
fezf-1	NP_502594.2	COG5048	<13..212	CDD:227381	50/135 (37%)
		DUF3449	<50..>70	CDD:288759	5/19 (26%)
		C2H2 Zn finger	54..74	CDD:275368	5/19 (26%)
		zf-H2C2_2	66..91	CDD:290200	13/24 (54%)
		C2H2 Zn finger	82..102	CDD:275368	9/20 (45%)
		C2H2 Zn finger	110..130	CDD:275368	6/19 (32%)
		C2H2 Zn finger	138..158	CDD:275368	8/19 (42%)
		C2H2 Zn finger	166..186	CDD:275368	7/18 (39%)
		C2H2 Zn finger	194..212	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000