DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and zf30C

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster


Alignment Length:662 Identity:138/662 - (20%)
Similarity:244/662 - (36%) Gaps:172/662 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CGLICVSRDYEKFLMRCSYCPTDVEVAQWQEFVLHIRNVHSKVRSMED-----DFEPVGENSTES 63
            ||...:.|: |...|.|..|.|....|.         |:....||..|     :::..|.:....
  Fly   119 CGEEKLPRE-ESRPMECKCCYTRFSSAS---------NLSKHRRSRPDTCGQPEYDSPGSSDGMK 173

  Fly    64 GHV---------DPPEEKPQAEESIFQQDESADGACVQLHIDAVRSSTNETEESDVSLVTDEEES 119
            .|.         |..:|...:|||   :|...|   :.|   |.|..|...:||..|   |..:.
  Fly   174 KHKAFRKKDRNRDSDDEDTTSEES---EDSDDD---IPL---ASRLKTKLKQESQNS---DSGDE 226

  Fly   120 VQDEDP--SEPALDDANLKTTPTYKFHPSFFRRDHRTIKFIEIYKEHPCLWNPAHSDYKEPKKCK 182
            ..|.:|  ||...|.:..:..|     |:..:        :|.:.|....:..|....|     .
  Fly   227 CPDFEPNNSEDDADASGFQLPP-----PAMVK--------VEAFDEEDFEYQDASMYVK-----T 273

  Fly   183 EALKRMAIDLEATVSVFLNE-------MALKL-----------AIKKVHMQFNTV---------- 219
            |:....:.:.:..:.|.|||       .:||:           |:..|.:....|          
  Fly   274 ESTDIFSNEKDKLLDVLLNEGDGLKPFESLKVEQGAGILDEIAAVPLVEVAEEDVLELRGHQMEK 338

  Fly   220 ----HKRVVSGKQKPQSLAFSIYKLCCFLNASNDEEGATNNEKIKLDFSKK---------NKLTT 271
                .||....|:|...:.....|.....:.|.|:...|.....|:  |||         ||:..
  Fly   339 PPGPRKRGRPPKEKIPVVKRKYRKRNAPRSPSPDDSSGTPKRVAKI--SKKELKERLKMINKMEK 401

  Fly   272 D-----LIEMYANFPQLYD----SNHKEFSNMSSRKQAYESMAAEISVPNVDINS---DDIFRA- 323
            .     .:::| :..:.|:    .:||  .|.:..|:.::         :||:::   :::|:. 
  Fly   402 SWKCPHCVKIY-HIRKPYEKHLRDDHK--LNEAEMKEIFK---------DVDVHAKLDEEVFKCP 454

  Fly   324 -IQNLRQWYYKNTKHAIYAGSTAEKFYLEVC---RFMPAK---------MYKQRLVCEFCHQITS 375
             ...:.....:...|....|...:..:...|   .|...|         .:|:.|.||.|.:..:
  Fly   455 ICSKIYLVEKRLVTHMKVHGEDGKLTFKCPCYCNLFFATKEQATEHARAQHKELLYCEKCDKYMT 519

  Fly   376 SDHVLQSHIFKAHNIGELPFK-----CTLCDRSFVGRCELANHIQRVHIGK--THKCTHCERSFA 433
            ....|::|....|:..|...:     |..|.:.|.||..|::|: |...|:  .:.|:.|.:..:
  Fly   520 GHDSLKNHERNFHSKKEPRSQQRNLICDKCGKKFTGRTSLSDHV-RSDCGRLPLYGCSVCGKHLS 583

  Fly   434 VMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKIRAFKCTMCPKDFVKKVDLSDH 498
            ....|:.|:..|....||.|:.|||.|::::|...|:...||..:.:||.:|||::..:..|..|
  Fly   584 TAGILKTHMLLHKADTPYQCDKCGKTFKVKAQYKSHLKTRHTDYKPYKCHLCPKEYPYRESLLTH 648

  Fly   499 IKGHLNIRDKICSVCGKGFTSCHALIRHRQIHSEVKKFVCKLC-----DSRFSQFVGLNTHMKRT 558
            :..|..|:..:|:.|||.||....|..||::|::.       |     :::.:|::|:       
  Fly   649 MTVHTGIKRFLCNNCGKRFTCISNLQAHRKVHADT-------CGQLPLNAKATQYMGV------- 699

  Fly   559 HNILRNNSQKGK 570
                    |:||
  Fly   700 --------QRGK 703

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916 19/118 (16%)
MADF_DNA_bdg 273..356 CDD:287510 12/94 (13%)
C2H2 Zn finger 367..388 CDD:275368 5/20 (25%)
C2H2 Zn finger 397..418 CDD:275368 8/20 (40%)
COG5048 <423..554 CDD:227381 38/135 (28%)
C2H2 Zn finger 425..445 CDD:275368 4/19 (21%)
zf-H2C2_2 437..460 CDD:290200 9/22 (41%)
C2H2 Zn finger 453..470 CDD:275368 6/16 (38%)
C2H2 Zn finger 482..502 CDD:275368 6/19 (32%)
C2H2 Zn finger 510..530 CDD:275368 9/19 (47%)
C2H2 Zn finger 538..559 CDD:275368 3/25 (12%)
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368
C2H2 Zn finger 134..152 CDD:275368 5/26 (19%)
C2H2 Zn finger 511..532 CDD:275370 5/20 (25%)
COG5048 <523..>672 CDD:227381 44/149 (30%)
C2H2 Zn finger 546..566 CDD:275368 8/20 (40%)
C2H2 Zn finger 575..595 CDD:275368 4/19 (21%)
C2H2 Zn finger 603..624 CDD:275368 7/20 (35%)
C2H2 Zn finger 632..652 CDD:275368 6/19 (32%)
C2H2 Zn finger 660..680 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440034
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.