DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and ZNF181

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:XP_016882229.1 Gene:ZNF181 / 339318 HGNCID:12971 Length:585 Species:Homo sapiens


Alignment Length:413 Identity:105/413 - (25%)
Similarity:163/413 - (39%) Gaps:119/413 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 VVSGKQKPQSLAFSIYKLCCFLNASNDEEGATNNEKI-------KLDFSKKNKLTTDLI--EMYA 278
            :::.::.|  .|.|:||...|.:..:.:...:..:||       |.|..|||.....:|  |...
Human   156 ILTSRESP--TADSVYKYNIFRSTFHSKSTLSEPQKISAEGNSHKYDILKKNLPKKSVIKNEKVN 218

  Fly   279 NFPQLYDSNHKEFSNMSSRKQAYESMAAEISVPNVDINSDDIF-----------RAIQNLRQWYY 332
            ...:|.:||         :..|..|....:::|.. .|.:.|:           ::|.| |.|  
Human   219 GGKKLLNSN---------KSGAAFSQGKSLTLPQT-CNREKIYTCSECGKAFGKQSILN-RHW-- 270

  Fly   333 KNTKHAIYAGSTAEKFYLEVCRFMPAKMYKQRLVCEFCHQITSSDHVLQSHIFKAHNIGELPFKC 397
                 .|:.|   ||.|                .|..|.:..|....|..|:. :|: ||.|:||
Human   271 -----RIHTG---EKPY----------------ECRECGKTFSHGSSLTRHLI-SHS-GEKPYKC 309

  Fly   398 TLCDRSFVGRCELANHIQRVHIG-KTHKCTHCERSFAVMSDLQLHIR------------------ 443
            ..|.::|.....|.|| |..|.| |.::|.:|.:||:.:|.|..|:|                  
Human   310 IECGKAFSHVSSLTNH-QSTHTGEKPYECMNCGKSFSRVSHLIEHLRIHTQEKLYECRICGKAFI 373

  Fly   444 ----------THTGHKPYVCEHCGKAFRLRSQMTLHV---------------------------T 471
                      .|||.|||.|..|||||...|.:|.|.                           .
Human   374 HRSSLIHHQKIHTGEKPYECRECGKAFCCSSHLTRHQRIHTMEKQYECNKCLKVFSSLSFLVQHQ 438

  Fly   472 AIHTKIRAFKCTMCPKDFVKKVDLSDHIKGHLNIRDKICSVCGKGFTSCHALIRHRQIHSEVKKF 536
            :|||:.:.|:|..|.|.|.:...|:.|::.|:.::...||:|||.|:...:|::|.:||:..|.:
Human   439 SIHTEEKPFECQKCRKSFNQLESLNMHLRNHIRLKPYECSICGKAFSHRSSLLQHHRIHTGEKPY 503

  Fly   537 VCKLCDSRFSQFVGLNTHMKRTH 559
            .|..|...||....|..| :|.|
Human   504 ECIKCGKTFSCSSNLTVH-QRIH 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916 5/20 (25%)
MADF_DNA_bdg 273..356 CDD:287510 19/95 (20%)
C2H2 Zn finger 367..388 CDD:275368 5/20 (25%)
C2H2 Zn finger 397..418 CDD:275368 7/20 (35%)
COG5048 <423..554 CDD:227381 50/185 (27%)
C2H2 Zn finger 425..445 CDD:275368 8/47 (17%)
zf-H2C2_2 437..460 CDD:290200 13/50 (26%)
C2H2 Zn finger 453..470 CDD:275368 8/16 (50%)
C2H2 Zn finger 482..502 CDD:275368 6/19 (32%)
C2H2 Zn finger 510..530 CDD:275368 8/19 (42%)
C2H2 Zn finger 538..559 CDD:275368 7/20 (35%)
ZNF181XP_016882229.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.