DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1602 and zld

DIOPT Version :9

Sequence 1:	NP_610291.2	Gene:	CG1602 / 35684	FlyBaseID:	FBgn0033186	Length:	577	Species:	Drosophila melanogaster
Sequence 2:	NP_001285466.1	Gene:	zld / 32994	FlyBaseID:	FBgn0259789	Length:	1596	Species:	Drosophila melanogaster

Alignment Length:	137	Identity:	40/137 - (29%)
Similarity:	59/137 - (43%)	Gaps:	28/137 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   396 KCTLCDRSFVGRCELANHIQRVHIGKTHKCTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAF 460
            ||..||:.|...|.|..|               .:||            |:|..|:.|:.|||.|
  Fly  1327 KCLECDKEFTKNCYLTQH---------------NKSF------------HSGEYPFRCQKCGKRF 1364

  Fly   461 RLRSQMTLHVTAIHTKIRAFKCTMCPKDFVKKVDLSDHIKG-HLNIRDKICSVCGKGFTSCHALI 524
            :.....|.|:....|:.:..||.:|||.|..|.||..|::. |..::..:|.:|.|||.....|.
  Fly  1365 QSEDVYTTHLGRHRTQDKPHKCELCPKQFHHKTDLRRHVEAIHTGLKQHMCDICEKGFCRKDHLR 1429

  Fly   525 RHRQIHS 531
            :|.:.|:
  Fly  1430 KHLETHN 1436

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1602	NP_610291.2	GT1	157..244	CDD:304916
		MADF_DNA_bdg	273..356	CDD:287510
		C2H2 Zn finger	367..388	CDD:275368
		C2H2 Zn finger	397..418	CDD:275368	7/20 (35%)
		COG5048	<423..554	CDD:227381	32/110 (29%)
		C2H2 Zn finger	425..445	CDD:275368	2/19 (11%)
		zf-H2C2_2	437..460	CDD:290200	7/22 (32%)
		C2H2 Zn finger	453..470	CDD:275368	6/16 (38%)
		C2H2 Zn finger	482..502	CDD:275368	9/20 (45%)
		C2H2 Zn finger	510..530	CDD:275368	7/19 (37%)
		C2H2 Zn finger	538..559	CDD:275368
zld	NP_001285466.1	zf-C2H2_jaz	552..577	CDD:288983
		LIM	1328..1389	CDD:259829	22/87 (25%)
		C2H2 Zn finger	1328..1349	CDD:275368	9/47 (19%)
		C2H2 Zn finger	1357..1377	CDD:275368	7/19 (37%)
		C2H2 Zn finger	1386..1407	CDD:275368	9/20 (45%)
		zf-H2C2_2	1398..1422	CDD:290200	7/23 (30%)
		zf-C2H2	1413..1435	CDD:278523	7/21 (33%)
		C2H2 Zn finger	1415..1435	CDD:275368	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24393
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100