| Sequence 1: | NP_610291.2 | Gene: | CG1602 / 35684 | FlyBaseID: | FBgn0033186 | Length: | 577 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_573329.2 | Gene: | CG7101 / 32875 | FlyBaseID: | FBgn0030963 | Length: | 352 | Species: | Drosophila melanogaster |
| Alignment Length: | 319 | Identity: | 64/319 - (20%) |
|---|---|---|---|
| Similarity: | 98/319 - (30%) | Gaps: | 113/319 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 349 YLEVCRFMPAKMYKQR--------LVCEFCHQITSSDHVLQSHIFKAHNIGEL------------ 393
Fly 394 ---------------PFKCTLCD------RSFVGRCELANHIQRVHIGKTHK------------- 424
Fly 425 ----------------------------------------------CTHCERSFAVMSDLQLHIR 443
Fly 444 THTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKIRAFKCTMCPKDFVKKVDLSDHIKGHLNI--- 505
Fly 506 --RDKICSVCGKGFTS-CHAL--IRHRQIHSEVKKFVCKLCDSRFSQFVGLNTHMKRTH 559 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1602 | NP_610291.2 | GT1 | 157..244 | CDD:304916 | |
| MADF_DNA_bdg | 273..356 | CDD:287510 | 2/6 (33%) | ||
| C2H2 Zn finger | 367..388 | CDD:275368 | 4/20 (20%) | ||
| C2H2 Zn finger | 397..418 | CDD:275368 | 7/26 (27%) | ||
| COG5048 | <423..554 | CDD:227381 | 38/197 (19%) | ||
| C2H2 Zn finger | 425..445 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 437..460 | CDD:290200 | 6/22 (27%) | ||
| C2H2 Zn finger | 453..470 | CDD:275368 | 5/16 (31%) | ||
| C2H2 Zn finger | 482..502 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 510..530 | CDD:275368 | 9/22 (41%) | ||
| C2H2 Zn finger | 538..559 | CDD:275368 | 5/20 (25%) | ||
| CG7101 | NP_573329.2 | PHA00733 | <210..263 | CDD:177301 | 11/52 (21%) |
| C2H2 Zn finger | 242..263 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 271..292 | CDD:275368 | 9/24 (38%) | ||
| C2H2 Zn finger | 300..319 | CDD:275368 | 9/18 (50%) | ||
| C2H2 Zn finger | 330..347 | CDD:275368 | 4/16 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45440039 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||