DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and CG11695

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:560 Identity:112/560 - (20%)
Similarity:188/560 - (33%) Gaps:147/560 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 AEES--IFQQDESAD-------GACVQLHIDAVRSSTNETEESDVSLVTDEEESVQDEDP----- 125
            ||.|  ||.||:|.|       ...::.|:..|....:...:   ||.|...:.:.|.:.     
  Fly    10 AEHSVPIFDQDDSGDQPVPSNLAELIEKHLQLVLLPNDGVSK---SLCTQCWQQLADFEQFCAMV 71

  Fly   126 SEPALDDANLKTTPTYKFHPSFFRRDHRTIKFIEIYKEHPCLWNPAHSDYKEPKKCKEALKRMAI 190
            .:..|....||..|        |..|.......:|..|.....:||.:|.:|   |.|      |
  Fly    72 MKKQLGLQQLKMEP--------FSEDEDADTKAQILCEPEIDVSPAAADNEE---CNE------I 119

  Fly   191 DLEATV--------SVFLNEMALKLAIKKVHMQFNTVHKRVVSGKQKPQSLAFSIYKLCCFLNAS 247
            |.:|:.        :..|.||.|...|::        ..|:......|::.|...........|.
  Fly   120 DGDASSNSRSSSIRTTSLREMRLPSPIRR--------RMRLPRAVTAPKTQAVKAKARTKTHKAE 176

  Fly   248 NDEEGATNNEKIKLDFSKKNKLTTDLIEMYANFPQLYDSNHKEFSNMSSRKQAYESMAAEISVPN 312
            .||:.....|......|..::.....|.::...........::|.|.:..|:             
  Fly   177 ADEDEDAEGEGDPESRSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKR------------- 228

  Fly   313 VDINSDDIFRAIQNLRQWYYKNTKHAIYAGSTAEKFYLEVCRFMPAKMYKQRLV----------- 366
                              :::|...::        .|:..|:    :.||:|.:           
  Fly   229 ------------------HFRNHHQSL--------GYVVCCQ----RRYKKRALYVDHLHMHNDP 263

  Fly   367 ----CEFCHQITSSDHVLQSHIFKAH-NIGELPFKCTLCDRSFVGRCELANHIQRVH-IGKTHKC 425
                |:.|.:...|......|:.:.| |..:|.|.|..|.:.|..:..|..| .||| ..:..:|
  Fly   264 NYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSFACDQCSKRFSKQFLLTIH-SRVHQQERNEQC 327

  Fly   426 THCERSFAVMSDLQLHI-RTH-TGHKPYVCEHCGKAFRLRSQMTLHVTAIH-------------- 474
            .||:|||....||:||: ||| ....|::|:.||..|:.:..:.:|...:|              
  Fly   328 KHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVHREGSQLPEVQCQEC 392

  Fly   475 --------------------TKIRAFKCTMCPKDFVKKVDLSDHIKGHLNIRDKICSVCGKGFTS 519
                                ..:|.:||..|..:...:..|:.||:.|.......|:.|.|.|.|
  Fly   393 QVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPKEYHKCTHCAKEFKS 457

  Fly   520 CHALIRHRQIHSEVKKFVCKLCDSRFSQFVGLNTHMKRTH 559
            ..:|..|...|:....:.|..|:..|.....::.|.::.|
  Fly   458 SRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKHRRQMH 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916 19/94 (20%)
MADF_DNA_bdg 273..356 CDD:287510 7/82 (9%)
C2H2 Zn finger 367..388 CDD:275368 4/20 (20%)
C2H2 Zn finger 397..418 CDD:275368 6/20 (30%)
COG5048 <423..554 CDD:227381 39/166 (23%)
C2H2 Zn finger 425..445 CDD:275368 11/20 (55%)
zf-H2C2_2 437..460 CDD:290200 11/24 (46%)
C2H2 Zn finger 453..470 CDD:275368 4/16 (25%)
C2H2 Zn finger 482..502 CDD:275368 5/19 (26%)
C2H2 Zn finger 510..530 CDD:275368 7/19 (37%)
C2H2 Zn finger 538..559 CDD:275368 4/20 (20%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 16/73 (22%)
C2H2 Zn finger 268..289 CDD:275368 4/20 (20%)
C2H2 Zn finger 299..319 CDD:275368 6/20 (30%)
C2H2 Zn finger 327..348 CDD:275368 11/20 (55%)
C2H2 Zn finger 357..376 CDD:275368 5/18 (28%)
C2H2 Zn finger 389..409 CDD:275368 0/19 (0%)
C2H2 Zn finger 420..440 CDD:275368 5/19 (26%)
C2H2 Zn finger 448..468 CDD:275368 7/19 (37%)
C2H2 Zn finger 476..494 CDD:275368 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439984
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.