DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and CG3032

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster


Alignment Length:445 Identity:92/445 - (20%)
Similarity:151/445 - (33%) Gaps:154/445 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DEEESVQDEDPSEPA-----LDDANLKTTPTYKFHPSFFRRDHRTIKFIEIYKEHPCLWNPAHSD 174
            :::||:...:|.|||     :|:..:|:.   |.....||....|:|         |        
  Fly   114 EDQESLHGLEPPEPAPDPDPIDEPAIKSD---KSPRKSFRGSRNTLK---------C-------- 158

  Fly   175 YKEPKKCKEALKRMAIDLEATVSVFLNEMALKLAIKKVHMQFNTVHKRVVSGKQKPQSLAFSIYK 239
                ..|:.:              |.:::.|...|:|||           .|.::|         
  Fly   159 ----SVCRRS--------------FAHQITLAAHIRKVH-----------EGSKRP--------- 185

  Fly   240 LCCFLNASNDEEGATNNEKIKLDFSKKNKLTTDLIEMYA-----------NFPQLYDS-----NH 288
            ..|              ::.:..:|....|.|.:.|::|           ...::|.|     .|
  Fly   186 FQC--------------DQCEKAYSFMGGLYTHIREVHAPKERRHPCDQPGCERIYTSRIAMQKH 236

  Fly   289 KEFSNMSSRKQAYESMAAEISVPNVDINSDDIFRAIQNLRQWYYKNTKH------AIYAGSTAEK 347
            |...:....:.|.:....|        .....|....||:  |:..|||      |...|...|:
  Fly   237 KRLKHSPRDRDALKKFICE--------QCGASFNQSANLK--YHLKTKHPTEDEVAAREGGAGER 291

  Fly   348 FYLEVCRFMPAKMYKQRLVCEFCHQITSSDHVLQSHIFKAHNIGELPFKCTLCDRSFVGRCELAN 412
            .:.::|:            .||..:.|...|.||.|..:.    |||.:|.:|.|...       
  Fly   292 HFCDICQ------------KEFHSRYTLKYHTLQQHEVQE----ELPHECQVCGRRMA------- 333

  Fly   413 HIQRVHIGKTHKCTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKI 477
                             :.|.::.    |:..|:..| ..|||||:.|..|.::..||.|:|.|:
  Fly   334 -----------------KKFMLLQ----HMLMHSNDK-LPCEHCGRRFARRFELEAHVRAVHLKL 376

  Fly   478 RAFKCTMCPKDFVKKVDLSDHIKGHLNIRDKICSVCGKGFTSCHALIRHRQIHSE 532
            :.|.|..||:.|..:..|..|...|...:..||..||:.|.....|..||::|.:
  Fly   377 KPFPCHHCPESFASRKTLRHHEYIHTGEKPYICDTCGQAFRQQTCLKNHRKVHEK 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916 11/86 (13%)
MADF_DNA_bdg 273..356 CDD:287510 19/104 (18%)
C2H2 Zn finger 367..388 CDD:275368 7/20 (35%)
C2H2 Zn finger 397..418 CDD:275368 3/20 (15%)
COG5048 <423..554 CDD:227381 33/110 (30%)
C2H2 Zn finger 425..445 CDD:275368 2/19 (11%)
zf-H2C2_2 437..460 CDD:290200 8/22 (36%)
C2H2 Zn finger 453..470 CDD:275368 7/16 (44%)
C2H2 Zn finger 482..502 CDD:275368 6/19 (32%)
C2H2 Zn finger 510..530 CDD:275368 7/19 (37%)
C2H2 Zn finger 538..559 CDD:275368
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071
C2H2 Zn finger 158..179 CDD:275368 6/46 (13%)
C2H2 Zn finger 188..209 CDD:275368 5/34 (15%)
C2H2 Zn finger 218..239 CDD:275368 4/20 (20%)
C2H2 Zn finger 254..275 CDD:275368 6/30 (20%)
C2H2 Zn finger 294..315 CDD:275368 7/32 (22%)
C2H2 Zn finger 325..345 CDD:275368 5/47 (11%)
C2H2 Zn finger 352..373 CDD:275368 10/20 (50%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
C2H2 Zn finger 409..429 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.