DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and sfc2

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_594670.1 Gene:sfc2 / 2542887 PomBaseID:SPAC144.09c Length:374 Species:Schizosaccharomyces pombe


Alignment Length:237 Identity:63/237 - (26%)
Similarity:97/237 - (40%) Gaps:48/237 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 EFCHQITSSDHVLQSHIFKAHNIGELPFKC--TLCDRSFVGRCELANHIQRVHIG-KTHKCTH-- 427
            |.|.:..|...:|:.|: :.|: .|.||.|  |.|.::|..:..|..| :|.|.. |...|.:  
pombe    28 EECGKKYSRPSLLEQHL-RTHS-NERPFVCDYTGCSKAFYRKSHLKIH-KRCHTNVKPFSCHYDG 89

  Fly   428 CERSFAVMSDLQLHIRTHTGHKPYVC--EHCGKAFRLRSQMTLHVTAIHTKIRAFKCTM--CPKD 488
            |:..|.....|:.||..|...|||.|  |.|.:.|....|:..|::|.||.:..:.||.  |...
pombe    90 CDAQFYTQQHLERHIEVHRKPKPYACTWEGCDECFSKHQQLRSHISACHTHLLPYPCTYQDCELR 154

  Fly   489 FVKKVDLSDHIK-----------------GH----------LNIRD---KICSVCGKGFTSC--- 520
            |..|..|.:|:.                 ||          .:||:   ..||:||:.|.:.   
pombe   155 FATKQKLQNHVNRAHEKIISYSCPHESCVGHEGFEKWSQLQNHIREAHVPSCSICGRQFKTAAHL 219

  Fly   521 -HALIRHRQIHSEVKKFVCKL--CDSRFSQFVGLNTHMKRTH 559
             |.::.|:....|.|.:.|.:  |...|::...|..|:...|
pombe   220 RHHVVLHQTTLEERKTYHCPMEGCKKSFTRSSALKKHISVIH 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916
MADF_DNA_bdg 273..356 CDD:287510
C2H2 Zn finger 367..388 CDD:275368 5/19 (26%)
C2H2 Zn finger 397..418 CDD:275368 7/22 (32%)
COG5048 <423..554 CDD:227381 43/172 (25%)
C2H2 Zn finger 425..445 CDD:275368 6/21 (29%)
zf-H2C2_2 437..460 CDD:290200 10/24 (42%)
C2H2 Zn finger 453..470 CDD:275368 5/18 (28%)
C2H2 Zn finger 482..502 CDD:275368 7/38 (18%)
C2H2 Zn finger 510..530 CDD:275368 7/23 (30%)
C2H2 Zn finger 538..559 CDD:275368 5/22 (23%)
sfc2NP_594670.1 COG5048 1..374 CDD:227381 63/237 (27%)
C2H2 Zn finger 28..47 CDD:275368 5/19 (26%)
C2H2 Zn finger 55..77 CDD:275368 7/22 (32%)
C2H2 Zn finger 85..107 CDD:275368 6/21 (29%)
C2H2 Zn finger 115..138 CDD:275368 7/22 (32%)
C2H2 Zn finger 146..165 CDD:275368 6/18 (33%)
C2H2 Zn finger 206..226 CDD:275368 6/19 (32%)
C2H2 Zn finger 238..261 CDD:275368 5/22 (23%)
C2H2 Zn finger 269..286 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.