powered by:
Protein Alignment CG1602 and ZNF688
DIOPT Version :9
Sequence 1: | NP_610291.2 |
Gene: | CG1602 / 35684 |
FlyBaseID: | FBgn0033186 |
Length: | 577 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_024305933.1 |
Gene: | ZNF688 / 146542 |
HGNCID: | 30489 |
Length: | 384 |
Species: | Homo sapiens |
Alignment Length: | 49 |
Identity: | 18/49 - (36%) |
Similarity: | 25/49 - (51%) |
Gaps: | 0/49 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 421 KTHKCTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLH 469
:.|.||.|.|.|...|.|..|.|.|:|.:|:.|..||..|:.:..:..|
Human 289 RRHVCTDCGRRFTYPSLLVSHRRMHSGERPFPCPECGMRFKRKFAVEAH 337
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165142452 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.