DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1602 and ZNF688

DIOPT Version :9

Sequence 1:	NP_610291.2	Gene:	CG1602 / 35684	FlyBaseID:	FBgn0033186	Length:	577	Species:	Drosophila melanogaster
Sequence 2:	XP_024305933.1	Gene:	ZNF688 / 146542	HGNCID:	30489	Length:	384	Species:	Homo sapiens

Alignment Length:	49	Identity:	18/49 - (36%)
Similarity:	25/49 - (51%)	Gaps:	0/49 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   421 KTHKCTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLH 469
            :.|.||.|.|.|...|.|..|.|.|:|.:|:.|..||..|:.:..:..|
Human   289 RRHVCTDCGRRFTYPSLLVSHRRMHSGERPFPCPECGMRFKRKFAVEAH 337

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1602	NP_610291.2	GT1	157..244	CDD:304916
		MADF_DNA_bdg	273..356	CDD:287510
		C2H2 Zn finger	367..388	CDD:275368
		C2H2 Zn finger	397..418	CDD:275368
		COG5048	<423..554	CDD:227381	18/47 (38%)
		C2H2 Zn finger	425..445	CDD:275368	9/19 (47%)
		zf-H2C2_2	437..460	CDD:290200	9/22 (41%)
		C2H2 Zn finger	453..470	CDD:275368	5/17 (29%)
		C2H2 Zn finger	482..502	CDD:275368
		C2H2 Zn finger	510..530	CDD:275368
		C2H2 Zn finger	538..559	CDD:275368
ZNF688	XP_024305933.1	KRAB	171..212	CDD:307490
		Zn-ribbon_8	<251..>318	CDD:321291	12/28 (43%)
		zf-C2H2	291..313	CDD:306579	10/21 (48%)
		C2H2 Zn finger	293..313	CDD:275368	9/19 (47%)
		zf-H2C2_2	306..330	CDD:316026	10/23 (43%)
		C2H2 Zn finger	321..341	CDD:275368	5/17 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165142452
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930