DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and Znf48

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:XP_008758156.1 Gene:Znf48 / 103690203 RGDID:9115869 Length:590 Species:Rattus norvegicus


Alignment Length:247 Identity:72/247 - (29%)
Similarity:98/247 - (39%) Gaps:57/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 VCEFCHQITSSDHVLQSHIFKAHNIGELPFKCTLCDRSFVGRCELANHIQRVHIG-KTHK----- 424
            ||..|.:.......|..|  :..:.||.|:||.:|.:.|........| ||.|.| |.::     
  Rat    84 VCGECGKSFRQMSDLVKH--QRTHTGEKPYKCGVCGKGFGDSSARIKH-QRTHTGEKPYRVRPPA 145

  Fly   425 -------------------CTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAF-----RLRSQ 465
                               |..|.:||...|||..|.|||||.|||.|..|||.|     |::.|
  Rat   146 PGPPKMPRSRIPAGERPTICGECGKSFRQSSDLVKHQRTHTGEKPYKCGICGKGFGDSSARIKHQ 210

  Fly   466 MTLH-------------------VTAIH---TKIRAFKCTMCPKDFVKKVDLSDHIKGHLNIRDK 508
            .| |                   ..|.|   .:.:.:.||.|.|.||....|..|.:.||..:..
  Rat   211 RT-HRGDQLPRPVVPRRQPSQAAPEATHRPKAQDKPYICTDCGKRFVLSCSLLSHQRSHLGPKPF 274

  Fly   509 ICSVCGKGFTSCHALIRHRQIHSEVKKFVCKLCDSRFSQFVGLNTHMKRTHN 560
            .|.||||.|.....|::|.::|:..|.::|..|...|:.......|: |||:
  Rat   275 GCDVCGKEFARGSDLVKHLRVHTGEKPYLCPECGKGFADSSARVKHL-RTHS 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916
MADF_DNA_bdg 273..356 CDD:287510
C2H2 Zn finger 367..388 CDD:275368 4/20 (20%)
C2H2 Zn finger 397..418 CDD:275368 6/20 (30%)
COG5048 <423..554 CDD:227381 50/181 (28%)
C2H2 Zn finger 425..445 CDD:275368 9/19 (47%)
zf-H2C2_2 437..460 CDD:290200 15/22 (68%)
C2H2 Zn finger 453..470 CDD:275368 9/40 (23%)
C2H2 Zn finger 482..502 CDD:275368 8/19 (42%)
C2H2 Zn finger 510..530 CDD:275368 8/19 (42%)
C2H2 Zn finger 538..559 CDD:275368 5/20 (25%)
Znf48XP_008758156.1 zf-C2H2 84..105 CDD:278523 5/22 (23%)
COG5048 85..471 CDD:227381 71/246 (29%)
C2H2 Zn finger 85..105 CDD:275368 4/21 (19%)
zf-H2C2_2 97..120 CDD:290200 8/24 (33%)
C2H2 Zn finger 113..133 CDD:275368 6/20 (30%)
C2H2 Zn finger 165..185 CDD:275368 9/19 (47%)
zf-C2H2 165..185 CDD:278523 9/19 (47%)
zf-H2C2_2 177..200 CDD:290200 15/22 (68%)
C2H2 Zn finger 193..213 CDD:275368 8/20 (40%)
C2H2 Zn finger 248..268 CDD:275368 8/19 (42%)
C2H2 Zn finger 276..296 CDD:275368 8/19 (42%)
zf-H2C2_2 288..312 CDD:290200 6/23 (26%)
C2H2 Zn finger 304..324 CDD:275368 5/20 (25%)
zf-H2C2_2 319..340 CDD:290200 4/8 (50%)
C2H2 Zn finger 332..352 CDD:275368
zf-C2H2 423..445 CDD:278523
C2H2 Zn finger 425..445 CDD:275368
zf-H2C2_2 437..461 CDD:290200
C2H2 Zn finger 453..537 CDD:275368
COG5048 495..>563 CDD:227381
zf-C2H2 515..537 CDD:278523
zf-H2C2_2 529..552 CDD:290200
C2H2 Zn finger 545..565 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335952
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.