DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and LOC100365363

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:XP_006228060.2 Gene:LOC100365363 / 100365363 RGDID:2319215 Length:670 Species:Rattus norvegicus


Alignment Length:542 Identity:140/542 - (25%)
Similarity:201/542 - (37%) Gaps:167/542 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ESDV--SLVTDEEESVQDEDPSEPALDDANLKTTPTYKFH----------------PSFFRRDHR 153
            |.||  ||:...:::...|.|.:....|...:.|.:..:|                .:||||   
  Rat   125 EYDVYSSLLMKGQKAAIKEKPYQCNECDKVFRYTSSLAYHRQIHTGEKLYKCVECGKAFFRR--- 186

  Fly   154 TIKFIEIYKEHPCLWNPAHSDYKEPKKCKEALKRMAIDLEATVSVFLNEMALKLAIKKVHMQFNT 218
              .::.:::.|       ||..| |.||.|..|           ||.....||            
  Rat   187 --SYLLVHERH-------HSGAK-PYKCNECGK-----------VFSQNSHLK------------ 218

  Fly   219 VHKRVVSGKQKPQSLAFSIYKLCCFLNASNDEEGATNNEKIKLDFSKKNKLTTDLIEMYANFPQL 283
            .|:|:.:| :||       ||  |     ||...|         ||.::.||..|:....:.|..
  Rat   219 SHRRIHTG-EKP-------YK--C-----NDCGKA---------FSVRSNLTHHLVIHTGDKPYK 259

  Fly   284 YDSNHKEFSNMSSRKQAYESMAAEISVPNVDINSDDIFRAIQNLRQWYYKNTKHAIYAGS----- 343
            .:...|.||..||......:...|  .|........:|.:..||      ||..||:.|.     
  Rat   260 CNECGKVFSQTSSLTIHRRTHTGE--KPYRCNECGKVFSSHSNL------NTHQAIHTGEKPYKC 316

  Fly   344 --------------------TAEKFY----------------LEVCRFMPAKMYKQRLVCEFCHQ 372
                                |.||.|                ..:......|.||    ||.|.:
  Rat   317 SECGKVFTQNSHLANHWRTHTGEKPYKCNECGKAFSVYSSLTTHLAIHTGEKPYK----CEECGK 377

  Fly   373 I-TSSDHVLQ-----------------SHIFKAHNI--------GELPFKCTLCDRSFVGRCELA 411
            : |.:.|:..                 .|..:..|:        ||.|:||:.|.::|..|..|.
  Rat   378 VFTQNSHLANHRGIHSGEKPYKCEECGKHFNQTSNLARHWRVHTGEKPYKCSECGKAFSVRSSLT 442

  Fly   412 NHIQRVHIG-KTHKCTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLHVTAIHT 475
            :| |.:|.| |.:||..|.:.|:..|.|.:|.|.|||.|||.|..|||||...|.:..| ..|||
  Rat   443 SH-QVIHTGEKPYKCAECGKVFSQTSSLSIHQRIHTGEKPYRCNECGKAFNSHSNLNTH-QVIHT 505

  Fly   476 KIRAFKCTMCPKDFVKKVDLSDHIKGHLNIRDKICSVCGKGFTSCHALIRHRQIHSEVKKFVCKL 540
            ..:.:||..|.|.|.:...|::|.:.|...:...|:.|||.|:...:|..|:.||:..|.|.|..
  Rat   506 GQKPYKCLECGKVFTQNSHLANHHRTHTGEKPYKCNECGKAFSVYSSLTTHQAIHTGEKPFKCNE 570

  Fly   541 CDSRFSQFVGLNTHM---KRTH 559
            |...|:|    |:|:   :|||
  Rat   571 CGKVFTQ----NSHLASHRRTH 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916 21/86 (24%)
MADF_DNA_bdg 273..356 CDD:287510 21/123 (17%)
C2H2 Zn finger 367..388 CDD:275368 6/38 (16%)
C2H2 Zn finger 397..418 CDD:275368 7/20 (35%)
COG5048 <423..554 CDD:227381 49/130 (38%)
C2H2 Zn finger 425..445 CDD:275368 7/19 (37%)
zf-H2C2_2 437..460 CDD:290200 13/22 (59%)
C2H2 Zn finger 453..470 CDD:275368 7/16 (44%)
C2H2 Zn finger 482..502 CDD:275368 6/19 (32%)
C2H2 Zn finger 510..530 CDD:275368 7/19 (37%)
C2H2 Zn finger 538..559 CDD:275368 7/23 (30%)
LOC100365363XP_006228060.2 KRAB 8..68 CDD:214630
SFP1 <143..221 CDD:227516 22/113 (19%)
C2H2 Zn finger 148..168 CDD:275368 3/19 (16%)
C2H2 Zn finger 176..196 CDD:275368 5/31 (16%)
COG5048 200..575 CDD:227381 116/436 (27%)
C2H2 Zn finger 204..224 CDD:275368 9/42 (21%)
C2H2 Zn finger 232..252 CDD:275368 9/33 (27%)
C2H2 Zn finger 260..280 CDD:275368 5/19 (26%)
C2H2 Zn finger 288..308 CDD:275368 6/25 (24%)
C2H2 Zn finger 316..336 CDD:275368 0/19 (0%)
C2H2 Zn finger 344..364 CDD:275368 0/19 (0%)
C2H2 Zn finger 372..392 CDD:275368 5/19 (26%)
C2H2 Zn finger 400..420 CDD:275368 2/19 (11%)
C2H2 Zn finger 428..448 CDD:275368 7/20 (35%)
C2H2 Zn finger 456..476 CDD:275368 7/19 (37%)
C2H2 Zn finger 484..504 CDD:275368 8/20 (40%)
C2H2 Zn finger 512..532 CDD:275368 6/19 (32%)
C2H2 Zn finger 540..560 CDD:275368 7/19 (37%)
C2H2 Zn finger 568..588 CDD:275368 7/23 (30%)
zf-H2C2_2 580..604 CDD:404364 4/9 (44%)
C2H2 Zn finger 596..615 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335945
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.