Sequence 1: | NP_610291.2 | Gene: | CG1602 / 35684 | FlyBaseID: | FBgn0033186 | Length: | 577 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001076468.1 | Gene: | zbtb49 / 100009630 | ZFINID: | ZDB-GENE-070209-170 | Length: | 524 | Species: | Danio rerio |
Alignment Length: | 215 | Identity: | 66/215 - (30%) |
---|---|---|---|
Similarity: | 95/215 - (44%) | Gaps: | 22/215 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 341 AGSTAEKFYLEVCRFMPAKMYKQRLVCEFCHQITSSDHVLQSHIFKAHNIGELPFKCTLCDRSFV 405
Fly 406 GRCELANHIQRVHIG-KTHKCTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLH 469
Fly 470 VTAIHTKIRAFKCTMCPKDFVKKVDLSDHIKGHLNIRDKICSVCGKGFTSCHALIRHRQIHSEVK 534
Fly 535 KFVCKLCDSRFSQFVGLNTH 554 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1602 | NP_610291.2 | GT1 | 157..244 | CDD:304916 | |
MADF_DNA_bdg | 273..356 | CDD:287510 | 5/14 (36%) | ||
C2H2 Zn finger | 367..388 | CDD:275368 | 2/20 (10%) | ||
C2H2 Zn finger | 397..418 | CDD:275368 | 6/20 (30%) | ||
COG5048 | <423..554 | CDD:227381 | 43/130 (33%) | ||
C2H2 Zn finger | 425..445 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 437..460 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 453..470 | CDD:275368 | 5/16 (31%) | ||
C2H2 Zn finger | 482..502 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 510..530 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 538..559 | CDD:275368 | 6/17 (35%) | ||
zbtb49 | NP_001076468.1 | zf-H2C2_2 | 322..346 | CDD:290200 | 9/24 (38%) |
C2H2 Zn finger | 338..358 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 366..386 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 378..402 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 394..414 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 407..430 | CDD:290200 | 7/22 (32%) | ||
C2H2 Zn finger | 422..442 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 434..459 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 450..467 | CDD:275368 | 6/17 (35%) | ||
BTB | 15..118 | CDD:279045 | |||
BTB | 26..118 | CDD:197585 | |||
zf-C2H2 | 280..302 | CDD:278523 | 7/40 (18%) | ||
C2H2 Zn finger | 282..302 | CDD:275368 | 7/38 (18%) | ||
COG5048 | <292..466 | CDD:227381 | 57/175 (33%) | ||
zf-H2C2_2 | 294..319 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 310..330 | CDD:275368 | 6/20 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24393 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |