DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1603 and wdn

DIOPT Version :9

Sequence 1:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_476900.1 Gene:wdn / 43398 FlyBaseID:FBgn0005642 Length:869 Species:Drosophila melanogaster


Alignment Length:563 Identity:130/563 - (23%)
Similarity:202/563 - (35%) Gaps:141/563 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DAADPAIAYGPDEFFEVIENSNGVD--QWMEADSKDIQYEEDATAWSAATNNSWEFGPGGSSLEL 129
            ||..|..| ..||....:...|..|  ..::.:|.||......|..||:..|       |:||..
  Fly    28 DAGTPTKA-AHDEILSSLLRINNFDSISSIKDESLDIDLSACVTISSASLVN-------GNSLSS 84

  Fly   130 PAGKEVTQMDESSQNHIPLNTDDDDVDCSDFFMSEDDLAPPRKPGRPPRRTRPG-QVFKFKVSFI 193
            .....|  :|||:||:..||...|        :..||||.......|...|... ...:|.|:|:
  Fly    85 TDFWRV--LDESAQNNTELNLSSD--------VCRDDLAATSSSTVPSTLTSDNHSSSEFSVTFL 139

  Fly   194 RSNPRVLHLIQAYKEHPCLWNPSDEHYQDEPARSMAYEAIMERMDRKANVLFTVEELKKTLEQLH 258
            |..|.     .|:...|.                           :|.:...|...:|.:.||||
  Fly   140 RPEPP-----NAFTNSPF---------------------------KKTSSSGTSTPVKLSPEQLH 172

  Fly   259 VQYTLALETKQ----RGKLVGLAA---RYFAKCEFLSVAPVVTPRENEEDNDLTAIKLNFKEENL 316
            .|:.|.:...|    :.||....|   :.|.:          .|.|.:...:....|:...|..|
  Fly   173 QQHQLQMPQSQLLQRKPKLPAATAVRLKVFKE----------EPPEEKHPPEQVVTKVEVCESEL 227

  Fly   317 ITTSFIETYANYPVLYNQALPDFGSIEIRADAFKR---MAKEFQPV----------VKAN----E 364
            :..||        .::.||    .|.|..|||...   .|.|.:|:          :..|    |
  Fly   228 LPPSF--------TIFQQA----KSAESVADAASMPPPAASETKPLEVDPAPLHKCLDCNGLLLE 280

  Fly   365 TDVYIAVNKLRRWLYDAIRRLKSKELIQKCSKQEVQYLQMCSFLP------AKGSESQVLYCDYC 423
            |...:|.::.      |..||:   |..:||:.:.::..:.....      .:|.:.....|..|
  Fly   281 TPDEVAKHEA------AAHRLR---LTYRCSECQREFELLAGLKKHLKTHRTEGRKDTWKKCPDC 336

  Fly   424 DK-----------RFHGDYNLRVHIVKAHEVGDLPYLCSFCPRRFDRHVDMDRHKLRSHFERKLK 477
            .|           :.|.|              :..|.|..|.::|.:.:::..|......|:..:
  Fly   337 GKCLKLGSMWMHRKIHSD--------------NKKYQCDICGQKFVQKINLTHHARIHSSEKPYE 387

  Fly   478 CQYCEKSFAVDTDLKVHTLIHTGERPHVCDICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTF 542
            |..|:|.|...:.|:.|...|...|.:.|:.|||.::.:..|..| |.|||..||::|.:|.|:|
  Fly   388 CPECQKRFQERSHLQRHQKYHAQTRSYRCEKCGKMYKTERCLKVH-NLVHLEQRPFACTVCDKSF 451

  Fly   543 RKKFELANHIKGHLNIRDKKCEYCDATFYDHSSLSRH-RRSHR 584
            ....:|..|...|..:|..||.||...|.:..:..:| ||.|:
  Fly   452 ISNSKLKQHSNIHTGMRPFKCNYCPRDFTNFPNWLKHTRRRHK 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510 16/91 (18%)
GT1 321..408 CDD:304916 21/103 (20%)
C2H2 Zn finger 420..441 CDD:275368 5/31 (16%)
COG5048 <424..583 CDD:227381 45/170 (26%)
C2H2 Zn finger 450..471 CDD:275368 4/20 (20%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
zf-H2C2_2 490..513 CDD:290200 8/22 (36%)
C2H2 Zn finger 506..527 CDD:275368 7/20 (35%)
C2H2 Zn finger 535..555 CDD:275368 6/19 (32%)
C2H2 Zn finger 563..583 CDD:275368 7/20 (35%)
wdnNP_476900.1 C2H2 Zn finger 301..321 CDD:275368 2/19 (11%)
RPB9 333..425 CDD:224510 23/105 (22%)
C2H2 Zn finger 333..352 CDD:275368 3/18 (17%)
zf-H2C2_2 344..369 CDD:290200 6/38 (16%)
zf-C2H2 358..380 CDD:278523 5/21 (24%)
C2H2 Zn finger 360..380 CDD:275368 4/19 (21%)
zf-H2C2_2 372..395 CDD:290200 5/22 (23%)
zf-C2H2 386..408 CDD:278523 6/21 (29%)
C2H2 Zn finger 388..436 CDD:275368 15/48 (31%)
zf-H2C2_2 400..425 CDD:290200 8/24 (33%)
C2H2 Zn finger 416..433 CDD:275368 6/17 (35%)
zf-H2C2_2 429..453 CDD:290200 12/24 (50%)
C2H2 Zn finger 444..464 CDD:275368 6/19 (32%)
zf-H2C2_2 457..481 CDD:290200 9/23 (39%)
C2H2 Zn finger 472..493 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457169
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.