DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1603 and sqz

DIOPT Version :9

Sequence 1:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster


Alignment Length:158 Identity:45/158 - (28%)
Similarity:84/158 - (53%) Gaps:12/158 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 GSESQVLYCDYCDKRFHGDYNLRVHIVKAHEVGDLPYLCSFCPRRFDRHVDMDRHKLRSHF-ERK 475
            |.:::...|..|.|.|.....|..| .:.| :|..||.|..|.|:|.:...:.:| :|:|. ::.
  Fly   152 GDQAKPYKCGSCSKSFANSSYLSQH-TRIH-LGIKPYRCEICQRKFTQLSHLQQH-IRTHTGDKP 213

  Fly   476 LKCQY--CEKSFAVDTDLKVHTLIHTGERPHVCDICGKTFRLKL-LLDH---HVNGVHLNIRPYS 534
            .||::  |.|:|:..::|:.|:..|..::|..|:.|.|.|..:: ||:|   |.:..||  :.:.
  Fly   214 YKCRHAGCPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHL--KTHI 276

  Fly   535 CNMCTKTFRKKFELANHIKGHLNIRDKK 562
            ||:|.|::.::..|..|::.|....:|:
  Fly   277 CNLCGKSYTQETYLQKHLQKHAEKAEKQ 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510
GT1 321..408 CDD:304916
C2H2 Zn finger 420..441 CDD:275368 6/20 (30%)
COG5048 <424..583 CDD:227381 42/146 (29%)
C2H2 Zn finger 450..471 CDD:275368 6/20 (30%)
C2H2 Zn finger 478..498 CDD:275368 6/21 (29%)
zf-H2C2_2 490..513 CDD:290200 7/22 (32%)
C2H2 Zn finger 506..527 CDD:275368 8/24 (33%)
C2H2 Zn finger 535..555 CDD:275368 6/19 (32%)
C2H2 Zn finger 563..583 CDD:275368 45/158 (28%)
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 6/20 (30%)
zf-H2C2_2 172..197 CDD:290200 10/26 (38%)
zf-C2H2 186..208 CDD:278523 7/22 (32%)
C2H2 Zn finger 188..208 CDD:275368 6/20 (30%)
zf-C2H2_8 191..271 CDD:292531 23/80 (29%)
zf-H2C2_2 200..227 CDD:290200 8/27 (30%)
C2H2 Zn finger 216..238 CDD:275368 6/21 (29%)
C2H2 Zn finger 246..266 CDD:275368 7/19 (37%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.