DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1603 and Blimp-1

DIOPT Version :9

Sequence 1:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster


Alignment Length:137 Identity:51/137 - (37%)
Similarity:72/137 - (52%) Gaps:3/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 GDLPYLCSFCPRRFDRHVDMDRHKLRSHF-ERKLKCQYCEKSFAVDTDLKVHTLIHTGERPHVCD 507
            |.:.|.|:.|.:.|.:..::..| ||:|. ||..||..|.|||.....|:.|.|:||||:||.||
  Fly   886 GKMHYECNVCCKTFGQLSNLKVH-LRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCD 949

  Fly   508 ICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKKCEYCDATFYD 572
            ||.|.|.....|..|:. :|...:||:|::|.:.|.:...|..|.:.|.|.|...|:.||..:..
  Fly   950 ICKKRFSSTSNLKTHLR-LHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYIS 1013

  Fly   573 HSSLSRH 579
            .|.|..|
  Fly  1014 ASGLRTH 1020

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510
GT1 321..408 CDD:304916
C2H2 Zn finger 420..441 CDD:275368
COG5048 <424..583 CDD:227381 51/137 (37%)
C2H2 Zn finger 450..471 CDD:275368 6/20 (30%)
C2H2 Zn finger 478..498 CDD:275368 8/19 (42%)
zf-H2C2_2 490..513 CDD:290200 14/22 (64%)
C2H2 Zn finger 506..527 CDD:275368 8/20 (40%)
C2H2 Zn finger 535..555 CDD:275368 5/19 (26%)
C2H2 Zn finger 563..583 CDD:275368 6/17 (35%)
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 6/20 (30%)
zf-H2C2_2 904..929 CDD:290200 12/25 (48%)
C2H2 Zn finger 920..940 CDD:275368 8/19 (42%)
zf-H2C2_2 932..957 CDD:290200 15/24 (63%)
C2H2 Zn finger 948..968 CDD:275368 8/20 (40%)
zf-H2C2_2 960..985 CDD:290200 8/25 (32%)
C2H2 Zn finger 976..996 CDD:275368 5/19 (26%)
C2H2 Zn finger 1004..1023 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.