DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1603 and CG30431

DIOPT Version :9

Sequence 1:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:170 Identity:54/170 - (31%)
Similarity:86/170 - (50%) Gaps:15/170 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 CDYCDKRFHGDYNLRVHIVKAHEVGDLPYLCSFCPRRFDRHVDMDRHKLRSHF------ERKLKC 478
            |..|:|:|..::.|::|:...|.:|::.|.|..|.:.|     ..||.||.|.      ||...|
  Fly   234 CPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNF-----ASRHSLRYHVKSVHSTERPFGC 293

  Fly   479 QYCEKSFAVDTDLKVHTLIHTGE-RPHV--CDICGKTFRLKLLLDHHVNGVHLNI-RPYSCNMCT 539
            |:|::.|.:.|.|..|...|||| :|.:  |..|.|::..|..|..|:...:.|: ||:.|:.|:
  Fly   294 QHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCS 358

  Fly   540 KTFRKKFELANHIKGHLNIRDKKCEYCDATFYDHSSLSRH 579
            |.|..:..|.:|:..|...:...|||||..:....:|:.|
  Fly   359 KAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNH 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510
GT1 321..408 CDD:304916
C2H2 Zn finger 420..441 CDD:275368 6/20 (30%)
COG5048 <424..583 CDD:227381 52/166 (31%)
C2H2 Zn finger 450..471 CDD:275368 7/20 (35%)
C2H2 Zn finger 478..498 CDD:275368 7/19 (37%)
zf-H2C2_2 490..513 CDD:290200 10/25 (40%)
C2H2 Zn finger 506..527 CDD:275368 6/20 (30%)
C2H2 Zn finger 535..555 CDD:275368 6/19 (32%)
C2H2 Zn finger 563..583 CDD:275368 7/17 (41%)
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 6/20 (30%)
C2H2 Zn finger 264..285 CDD:275368 8/25 (32%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-C2H2_8 305..373 CDD:292531 22/67 (33%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 366..389 CDD:290200 8/22 (36%)
C2H2 Zn finger 382..403 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7426
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.