DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1603 and sna

DIOPT Version :9

Sequence 1:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster


Alignment Length:153 Identity:40/153 - (26%)
Similarity:70/153 - (45%) Gaps:10/153 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 VKAHEVGDLPYLCSFCPRRFDRHVDMDRHK------LRSHFERKL-KCQYCEKSFAVDTDLKVHT 495
            |.|:...:..:.|..|.:.:...:.:.:|:      ...:.|:|. .|:.|.|.:.....||:|.
  Fly   235 VAANHAKNYRFKCDECQKMYSTSMGLSKHRQFHCPAAECNQEKKTHSCEECGKLYTTIGALKMHI 299

  Fly   496 LIHTGERPHVCDICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRD 560
            ..||  .|..|.||||.|....||..|:. .|...:|:.|..|.::|..:..|..|.:.|::::.
  Fly   300 RTHT--LPCKCPICGKAFSRPWLLQGHIR-THTGEKPFQCPDCPRSFADRSNLRAHQQTHVDVKK 361

  Fly   561 KKCEYCDATFYDHSSLSRHRRSH 583
            ..|:.|..:|...|.|::|..|:
  Fly   362 YACQVCHKSFSRMSLLNKHSSSN 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510
GT1 321..408 CDD:304916
C2H2 Zn finger 420..441 CDD:275368 1/2 (50%)
COG5048 <424..583 CDD:227381 39/151 (26%)
C2H2 Zn finger 450..471 CDD:275368 3/26 (12%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
zf-H2C2_2 490..513 CDD:290200 11/22 (50%)
C2H2 Zn finger 506..527 CDD:275368 9/20 (45%)
C2H2 Zn finger 535..555 CDD:275368 5/19 (26%)
C2H2 Zn finger 563..583 CDD:275368 6/19 (32%)
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 9/20 (45%)
zf-H2C2_2 321..344 CDD:290200 6/23 (26%)
zf-C2H2 334..356 CDD:278523 5/21 (24%)
C2H2 Zn finger 336..356 CDD:275368 5/19 (26%)
zf-H2C2_2 348..373 CDD:290200 6/24 (25%)
C2H2 Zn finger 364..380 CDD:275368 5/15 (33%)
C2H2 Zn finger 247..267 CDD:275368 3/19 (16%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-C2H2 306..328 CDD:278523 9/22 (41%)
COG5048 307..>356 CDD:227381 16/49 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.