| Sequence 1: | NP_001260778.1 | Gene: | CG1603 / 35683 | FlyBaseID: | FBgn0033185 | Length: | 586 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_476600.1 | Gene: | esg / 34903 | FlyBaseID: | FBgn0001981 | Length: | 470 | Species: | Drosophila melanogaster |
| Alignment Length: | 212 | Identity: | 54/212 - (25%) |
|---|---|---|---|
| Similarity: | 87/212 - (41%) | Gaps: | 36/212 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 398 EVQYLQMCSFLPAKGSESQVLYCDYCDKRFHGDYNLRVHIVK-----AHEVGDLP---------- 447
Fly 448 --------YLCSFCPRRFDRHVDMDRHKL-------RSHFERKLKCQYCEKSFAVDTDLKVHTLI 497
Fly 498 HTGERPHVCDICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKK 562
Fly 563 CEYCDATFYDHSSLSRH 579 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1603 | NP_001260778.1 | MADF_DNA_bdg | 202..287 | CDD:287510 | |
| GT1 | 321..408 | CDD:304916 | 4/9 (44%) | ||
| C2H2 Zn finger | 420..441 | CDD:275368 | 5/25 (20%) | ||
| COG5048 | <424..583 | CDD:227381 | 45/186 (24%) | ||
| C2H2 Zn finger | 450..471 | CDD:275368 | 3/27 (11%) | ||
| C2H2 Zn finger | 478..498 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 490..513 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 506..527 | CDD:275368 | 8/20 (40%) | ||
| C2H2 Zn finger | 535..555 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 563..583 | CDD:275368 | 7/17 (41%) | ||
| esg | NP_476600.1 | zf-C2H2 | 309..331 | CDD:278523 | 4/21 (19%) |
| C2H2 Zn finger | 311..331 | CDD:275370 | 3/19 (16%) | ||
| zf-C2H2 | 344..366 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 346..366 | CDD:275368 | 6/19 (32%) | ||
| zf-C2H2 | 370..392 | CDD:278523 | 8/22 (36%) | ||
| C2H2 Zn finger | 372..392 | CDD:275368 | 8/20 (40%) | ||
| zf-H2C2_2 | 385..408 | CDD:290200 | 7/23 (30%) | ||
| zf-C2H2 | 398..420 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 400..420 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 428..444 | CDD:275368 | 6/15 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45457182 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||