DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1603 and Cf2

DIOPT Version :9

Sequence 1:	NP_001260778.1	Gene:	CG1603 / 35683	FlyBaseID:	FBgn0033185	Length:	586	Species:	Drosophila melanogaster
Sequence 2:	NP_001350854.1	Gene:	Cf2 / 33692	FlyBaseID:	FBgn0000286	Length:	537	Species:	Drosophila melanogaster

Alignment Length:	121	Identity:	43/121 - (35%)
Similarity:	56/121 - (46%)	Gaps:	14/121 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   466 HKLRSHFERKLKCQYCEKSFAVDTDLKVHTLIHTG-------ERPHVCDICGKTFRLKLLLDHHV 523
            ||:|.      ||..|.|:|.....|.:|..||||       |||:.|..|||:|.....|..|.
  Fly   362 HKIRH------KCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHT 420

  Fly   524 NGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKKCEYCDATFYDHSSLSRH 579
            . :|...:|:.|..|.|:|..|..|..||:.|...:...|.|||..|...|:|:.|
  Fly   421 R-IHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVH 475

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1603	NP_001260778.1	MADF_DNA_bdg	202..287	CDD:287510
		GT1	321..408	CDD:304916
		C2H2 Zn finger	420..441	CDD:275368
		COG5048	<424..583	CDD:227381	43/121 (36%)
		C2H2 Zn finger	450..471	CDD:275368	3/4 (75%)
		C2H2 Zn finger	478..498	CDD:275368	6/19 (32%)
		zf-H2C2_2	490..513	CDD:290200	13/29 (45%)
		C2H2 Zn finger	506..527	CDD:275368	7/20 (35%)
		C2H2 Zn finger	535..555	CDD:275368	8/19 (42%)
		C2H2 Zn finger	563..583	CDD:275368	8/17 (47%)
Cf2	NP_001350854.1	COG5048	<366..>473	CDD:227381	38/113 (34%)
		C2H2 Zn finger	368..388	CDD:275368	6/19 (32%)
		C2H2 Zn finger	403..423	CDD:275368	7/20 (35%)
		C2H2 Zn finger	431..451	CDD:275368	8/19 (42%)
		zf-H2C2_2	443..468	CDD:316026	9/24 (38%)
		C2H2 Zn finger	459..480	CDD:275368	8/17 (47%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45457179
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930