DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1603 and CG1529

DIOPT Version :9

Sequence 1:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster


Alignment Length:259 Identity:64/259 - (24%)
Similarity:106/259 - (40%) Gaps:24/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 PDFGSIEIRADAFKRMAKEFQPVVKANETDVYIAVNKLRRWLYDAIRRLKSKELIQKCSKQEVQY 401
            ||.|..|...:....:.:|.:......:.|:.......::.|.|.    :.:|...:....:.|.
  Fly    97 PDEGLKENHEENEHELEEEHEKQADGQQVDLSKKQEDQKKILDDR----EDEEYPDEYENSQQQL 157

  Fly   402 LQMCSFLPAKGSESQV-LYCDYCDKRFHGDYNLRVHIVKAHEVGDLPYLCSFCPRRFDRHVDMDR 465
            .|      ..||:.:. |.||.|.|:.:....|..||...|:....|:||..|.:.|.|:..:..
  Fly   158 SQ------GTGSKRRAGLACDQCGKQVYKLPYLEAHIRSVHQGYSKPFLCRSCDKSFTRYEQLRS 216

  Fly   466 HKLRSHFE--------RKLKCQYCEKSFAVDTDLKVHTLIHTGERPHVCDICG--KTFRLKLLLD 520
            |...:|.:        |.|.|:.|.:.::....|..|...|...:.|||:.||  |..|.:||. 
  Fly   217 HMRNAHPQLEQLQQELRDLICELCNRQYSTKNALGEHLKRHAQRKEHVCEHCGVAKVTRTELLT- 280

  Fly   521 HHVNGVHLNIRPYSCNMCTKTFRKKFELANHIK-GHLNIRDKKCEYCDATFYDHSSLSRHRRSH 583
             |:...:.....:.|..|.:.||.|..::.|:: .|...|..:|.:|:..|..|:|..||.|.|
  Fly   281 -HLRTHNPTWERFKCEQCPQLFRHKSAISRHVRVVHEGQRRFQCGHCEKKFGTHASQVRHERLH 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510
GT1 321..408 CDD:304916 11/70 (16%)
C2H2 Zn finger 420..441 CDD:275368 7/20 (35%)
COG5048 <424..583 CDD:227381 46/169 (27%)
C2H2 Zn finger 450..471 CDD:275368 5/20 (25%)
C2H2 Zn finger 478..498 CDD:275368 4/19 (21%)
zf-H2C2_2 490..513 CDD:290200 9/24 (38%)
C2H2 Zn finger 506..527 CDD:275368 8/22 (36%)
C2H2 Zn finger 535..555 CDD:275368 6/20 (30%)
C2H2 Zn finger 563..583 CDD:275368 8/19 (42%)
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071
C2H2 Zn finger 171..192 CDD:275368 7/20 (35%)
zf-C2H2_2 201..>257 CDD:289522 12/55 (22%)
C2H2 Zn finger 201..222 CDD:275368 5/20 (25%)
C2H2 Zn finger 237..257 CDD:275368 4/19 (21%)
C2H2 Zn finger 265..285 CDD:275368 8/21 (38%)
zf-C2H2_8 268..349 CDD:292531 24/78 (31%)
C2H2 Zn finger 294..315 CDD:275368 6/20 (30%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
C2H2 Zn finger 360..380 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473294
Domainoid 1 1.000 48 1.000 Domainoid score I8018
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.