DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1603 and zld

DIOPT Version :9

Sequence 1:	NP_001260778.1	Gene:	CG1603 / 35683	FlyBaseID:	FBgn0033185	Length:	586	Species:	Drosophila melanogaster
Sequence 2:	NP_001285466.1	Gene:	zld / 32994	FlyBaseID:	FBgn0259789	Length:	1596	Species:	Drosophila melanogaster

Alignment Length:	111	Identity:	32/111 - (28%)
Similarity:	53/111 - (47%)	Gaps:	2/111 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   475 KLKCQYCEKSFAVDTDLKVHT-LIHTGERPHVCDICGKTFRLKLLLDHHVNGVHLNIRPYSCNMC 538
            ::||..|:|.|..:..|..|. ..|:||.|..|..|||.|:.:.:...|:.......:|:.|.:|
  Fly  1325 RIKCLECDKEFTKNCYLTQHNKSFHSGEYPFRCQKCGKRFQSEDVYTTHLGRHRTQDKPHKCELC 1389

  Fly   539 TKTFRKKFELANHIKG-HLNIRDKKCEYCDATFYDHSSLSRHRRSH 583
            .|.|..|.:|..|::. |..::...|:.|:..|.....|.:|..:|
  Fly  1390 PKQFHHKTDLRRHVEAIHTGLKQHMCDICEKGFCRKDHLRKHLETH 1435

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1603	NP_001260778.1	MADF_DNA_bdg	202..287	CDD:287510
		GT1	321..408	CDD:304916
		C2H2 Zn finger	420..441	CDD:275368
		COG5048	<424..583	CDD:227381	31/109 (28%)
		C2H2 Zn finger	450..471	CDD:275368
		C2H2 Zn finger	478..498	CDD:275368	6/20 (30%)
		zf-H2C2_2	490..513	CDD:290200	10/23 (43%)
		C2H2 Zn finger	506..527	CDD:275368	6/20 (30%)
		C2H2 Zn finger	535..555	CDD:275368	7/20 (35%)
		C2H2 Zn finger	563..583	CDD:275368	5/19 (26%)
zld	NP_001285466.1	zf-C2H2_jaz	552..577	CDD:288983
		LIM	1328..1389	CDD:259829	18/60 (30%)
		C2H2 Zn finger	1328..1349	CDD:275368	6/20 (30%)
		C2H2 Zn finger	1357..1377	CDD:275368	6/19 (32%)
		C2H2 Zn finger	1386..1407	CDD:275368	7/20 (35%)
		zf-H2C2_2	1398..1422	CDD:290200	5/23 (22%)
		zf-C2H2	1413..1435	CDD:278523	5/21 (24%)
		C2H2 Zn finger	1415..1435	CDD:275368	5/19 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45457173
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930