DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1603 and CG42726

DIOPT Version :9

Sequence 1:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster


Alignment Length:167 Identity:50/167 - (29%)
Similarity:83/167 - (49%) Gaps:4/167 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 CDYCDKRFHGDYNLRVHIVKAHEVGDLPYLCSFCPRRFDRHVDMDRHKLRSHFERKLKCQYCEKS 484
            |..|.:||....:|:.|:: :|| ....:.||.|.:.|.:.:.:.||.| :|.:.|..|..|:|.
  Fly   103 CKECGRRFATSSHLKYHLM-SHE-KQSKHSCSVCHKSFKQPIVLQRHML-THNQEKHLCPICQKV 164

  Fly   485 FAVDTDLKVHTLIHTG-ERPHVCDICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFEL 548
            |...:.|..|..||:. .....|::|.|.|:.|..|:.|:.....|...:.|.:|.|:|.::..|
  Fly   165 FRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQTTL 229

  Fly   549 ANHIKGHLNIRDKKCEYCDATFYDHSSLSRHRRSHRS 585
            ..|:|.|.|...:.|..|..::.|..:|.||.|.|::
  Fly   230 RLHMKRHSNRERQSCSLCGKSYNDPDALGRHLRQHKT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510
GT1 321..408 CDD:304916
C2H2 Zn finger 420..441 CDD:275368 6/20 (30%)
COG5048 <424..583 CDD:227381 47/159 (30%)
C2H2 Zn finger 450..471 CDD:275368 7/20 (35%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
zf-H2C2_2 490..513 CDD:290200 7/23 (30%)
C2H2 Zn finger 506..527 CDD:275368 7/20 (35%)
C2H2 Zn finger 535..555 CDD:275368 7/19 (37%)
C2H2 Zn finger 563..583 CDD:275368 7/19 (37%)
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 6/20 (30%)
COG5048 <112..288 CDD:227381 46/158 (29%)
C2H2 Zn finger 131..151 CDD:275368 7/20 (35%)
Chordopox_A33R 151..>254 CDD:283591 29/102 (28%)
C2H2 Zn finger 158..178 CDD:275368 6/19 (32%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368 7/19 (37%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
C2H2 Zn finger 272..290 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457177
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.