DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1603 and ZNF664

DIOPT Version :9

Sequence 1:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001191227.1 Gene:ZNF664 / 144348 HGNCID:25406 Length:261 Species:Homo sapiens


Alignment Length:172 Identity:59/172 - (34%)
Similarity:78/172 - (45%) Gaps:13/172 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 CDYCDKRFHGDYNLRVHIVKAH-----EVGDLPYLCSFCPRRFDRHVDMDRHKLRSHFERKLKCQ 479
            ||.|||.|       .||.:.|     ..|:..|.|..|.:.|.....::|||.....|:..||.
Human    33 CDKCDKGF-------FHISELHIHWRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKCY 90

  Fly   480 YCEKSFAVDTDLKVHTLIHTGERPHVCDICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRK 544
            .|.|:|...:.|::|..:||||:|:||..||:.|.....|..| ..||...:|:.|..|.|.||.
Human    91 ECGKAFNWSSHLQIHMRVHTGEKPYVCSECGRGFSNSSNLCMH-QRVHTGEKPFKCEECGKAFRH 154

  Fly   545 KFELANHIKGHLNIRDKKCEYCDATFYDHSSLSRHRRSHRSE 586
            ...|..|.:.|...:..||..|...|...|||..|:|.|..|
Human   155 TSSLCMHQRVHTGEKPYKCYECGKAFSQSSSLCIHQRVHTGE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510
GT1 321..408 CDD:304916
C2H2 Zn finger 420..441 CDD:275368 8/20 (40%)
COG5048 <424..583 CDD:227381 54/163 (33%)
C2H2 Zn finger 450..471 CDD:275368 6/20 (30%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
zf-H2C2_2 490..513 CDD:290200 11/22 (50%)
C2H2 Zn finger 506..527 CDD:275368 6/20 (30%)
C2H2 Zn finger 535..555 CDD:275368 7/19 (37%)
C2H2 Zn finger 563..583 CDD:275368 8/19 (42%)
ZNF664NP_001191227.1 C2H2 Zn finger 5..25 CDD:275368
C2H2 Zn finger 33..53 CDD:275368 9/26 (35%)
C2H2 Zn finger 61..81 CDD:275368 6/19 (32%)
zf-H2C2_2 74..97 CDD:404364 8/22 (36%)
C2H2 Zn finger 89..109 CDD:275368 6/19 (32%)
COG5048 <94..256 CDD:227381 38/104 (37%)
C2H2 Zn finger 117..137 CDD:275368 6/20 (30%)
C2H2 Zn finger 145..165 CDD:275368 7/19 (37%)
C2H2 Zn finger 173..193 CDD:275368 8/19 (42%)
C2H2 Zn finger 201..221 CDD:275368
C2H2 Zn finger 229..249 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7426
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.