DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1603 and ZBTB18

DIOPT Version :9

Sequence 1:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_991331.1 Gene:ZBTB18 / 10472 HGNCID:13030 Length:531 Species:Homo sapiens


Alignment Length:511 Identity:104/511 - (20%)
Similarity:172/511 - (33%) Gaps:158/511 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 EADSKDIQYEEDATAWSAATNNSWEFGPGGSSLELPAGKEVTQMDESSQNHI----PLNTDDDDV 155
            ||||  .:.||||::.|                     .:|..:.:.| :||    |.:.|:.:.
Human   133 EADS--TKKEEDASSCS---------------------DKVESLSDGS-SHIAGDLPSDEDEGED 173

  Fly   156 DCSDFFMSEDDLAPPRKPGRPPRRTRPGQVFKFKVSFIRSNPRV-----LHLIQAYK--EHPCLW 213
            :..:...|:.|||           ..||.::....|.....|:.     .|...|.|  ..||  
Human   174 EKLNILPSKRDLA-----------AEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPC-- 225

  Fly   214 NPSDEHYQDEPARSMAYEAIMERMDRKANVLFTVEELKKTLEQLHVQYTLALETKQRGKLVGLAA 278
                  ...|.....:..::.:..|....:..:|:.....:|.|:..| .:.:...|..||.:..
Human   226 ------SSTESLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSY-FSSQDVLRSNLVQVKV 283

  Fly   279 RYFAKCEFLSVAPVVTPRENEEDNDLTAIKLNFKEENLITTSFIETYANYPVLYNQA--LPDFGS 341
            ...|.|:...|.      .|:.|.:.:.:|     |::.|        |..|.|..|  .|    
Human   284 EKEASCDESDVG------TNDYDMEHSTVK-----ESVST--------NNRVQYEPAHLAP---- 325

  Fly   342 IEIRADAFKRMAKEFQPVVKANETDVYIAVNKLRRWLYDAIRRLKSKELIQKCSKQEVQYLQMCS 406
              :|.|:   :.:|.....||::.::                .....|.:|.....|...|...|
Human   326 --LREDS---VLRELDREDKASDDEM----------------MTPESERVQVEGGMESSLLPYVS 369

  Fly   407 FL--PAKGSESQVLYCDYCDKRFHGDYNLRVHIVKAHEVGDLPYLCSFCPRRFDRHVDMDRHKLR 469
            .:  ||    .|:..|..|:|.|...:.|::|                               |.
Human   370 NILSPA----GQIFMCPLCNKVFPSPHILQIH-------------------------------LS 399

  Fly   470 SHFERK-------------LKCQYCEKSFAVDTDLKVHTLIHTGERPHVCDICGKTFRLKLLLDH 521
            :||..:             ..|..|.|:|:....||.|...|:||:|:.|..|||:|:....|..
Human   400 THFREQDGIRSKPAADVNVPTCSLCGKTFSCMYTLKRHERTHSGEKPYTCTQCGKSFQYSHNLSR 464

  Fly   522 HVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKKCEYCDATFYDHSSLS 577
            |. .||...:|::|..|.:.|.:..:|..|      ||...||..::......:||
Human   465 HA-VVHTREKPHACKWCERRFTQSGDLYRH------IRKFHCELVNSLSVKSEALS 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510 15/86 (17%)
GT1 321..408 CDD:304916 15/88 (17%)
C2H2 Zn finger 420..441 CDD:275368 6/20 (30%)
COG5048 <424..583 CDD:227381 39/167 (23%)
C2H2 Zn finger 450..471 CDD:275368 1/20 (5%)
C2H2 Zn finger 478..498 CDD:275368 7/19 (37%)
zf-H2C2_2 490..513 CDD:290200 11/22 (50%)
C2H2 Zn finger 506..527 CDD:275368 7/20 (35%)
C2H2 Zn finger 535..555 CDD:275368 5/19 (26%)
C2H2 Zn finger 563..583 CDD:275368 4/15 (27%)
ZBTB18NP_991331.1 BTB 23..119 CDD:279045
BTB 34..119 CDD:197585
COG5048 <303..>490 CDD:227381 54/260 (21%)
C2H2 Zn finger 381..401 CDD:275368 7/50 (14%)
C2H2 Zn finger 421..441 CDD:275368 7/19 (37%)
zf-H2C2_2 434..456 CDD:290200 11/21 (52%)
C2H2 Zn finger 449..469 CDD:275368 7/20 (35%)
C2H2 Zn finger 477..495 CDD:275368 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.