DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and ZNF84

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001120844.1 Gene:ZNF84 / 7637 HGNCID:13159 Length:738 Species:Homo sapiens


Alignment Length:347 Identity:98/347 - (28%)
Similarity:150/347 - (43%) Gaps:65/347 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 FTEENQLTTQFIDLYSKFPQLYDPAHKHFCNLNVRKSSLIEITDLLTSEFSLGLVTHYDVYDSIQ 330
            |:.::||.|.........|.......|.|    ..||.||....:.|.|      ..|:..:..:
Human   356 FSRKSQLVTHHRTHTGTKPFGCSDCRKAF----FEKSELIRHQTIHTGE------KPYECSECRK 410

  Fly   331 SMRQWYS--RRIKTLTD------VQCVGLSLAEKQYI---------------ERCNSFMPTKSFR 372
            :.|:..|  ...:|.|.      :|| |.:.::|.::               .:|.     |:|.
Human   411 AFRERSSLINHQRTHTGEKPHGCIQC-GKAFSQKSHLISHQMTHTGEKPFICSKCG-----KAFS 469

  Fly   373 QK---------------LKCEVCEHSFSTDHALQAHQFRDHKMGDGGWFRCTLCELNFDRKCHLQ 422
            :|               .:|..|..:||...:|..|| |.| .|:..:. |:.|...|.:|.||.
Human   470 RKSQLVRHQRTHTGEKPYECSECGKAFSEKLSLTNHQ-RIH-TGEKPYV-CSECGKAFCQKSHLI 531

  Fly   423 QHSQRVHM-DKSFVCEICSRSFAFGNQLAIHKRTHDEKHVAKPFVCEFCGKCFKQKIQMTTHVTA 486
            .| ||.|. :|.:.|..|.::|...:.||.|:|||..:   ||:.|..|.|.|.||.|:.|| ..
Human   532 SH-QRTHTGEKPYECSECGKAFGEKSSLATHQRTHTGE---KPYECRDCEKAFSQKSQLNTH-QR 591

  Fly   487 VHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANALVKHRHIHK-EKTLQ 550
            :||..:.::|.:|.|.|..|.:|..|::.|...:...|..|:|||...::|:.|:.||. ||..:
Human   592 IHTGEKPYECSLCRKAFFEKSELIRHLRTHTGEKPYECNECRKAFREKSSLINHQRIHTGEKPFE 656

  Fly   551 CSLCTTRFSERVSLGVHMRRTH 572
            ||.|...||.:..|..| :|||
Human   657 CSECGKAFSRKSHLIPH-QRTH 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916 12/66 (18%)
C2H2 Zn finger 377..398 CDD:275368 8/20 (40%)
C2H2 Zn finger 408..429 CDD:275368 9/20 (45%)
C2H2 Zn finger 436..456 CDD:275368 7/19 (37%)
C2H2 Zn finger 467..488 CDD:275368 9/20 (45%)
C2H2 Zn finger 496..516 CDD:275368 7/19 (37%)
C2H2 Zn finger 524..544 CDD:275368 7/19 (37%)
C2H2 Zn finger 551..572 CDD:275368 8/20 (40%)
ZNF84NP_001120844.1 KRAB 9..68 CDD:214630
C2H2 Zn finger 209..229 CDD:275368
C2H2 Zn finger 237..257 CDD:275368
C2H2 Zn finger 265..285 CDD:275368
zf-H2C2_2 278..302 CDD:316026
C2H2 Zn finger 293..313 CDD:275368
COG5048 317..724 CDD:227381 98/347 (28%)
C2H2 Zn finger 321..341 CDD:275368
C2H2 Zn finger 349..369 CDD:275368 4/12 (33%)
C2H2 Zn finger 377..397 CDD:275368 6/23 (26%)
C2H2 Zn finger 405..425 CDD:275368 2/19 (11%)
C2H2 Zn finger 433..453 CDD:275368 4/20 (20%)
C2H2 Zn finger 461..481 CDD:275368 4/24 (17%)
C2H2 Zn finger 489..509 CDD:275368 8/20 (40%)
C2H2 Zn finger 517..537 CDD:275368 9/20 (45%)
C2H2 Zn finger 545..565 CDD:275368 7/19 (37%)
C2H2 Zn finger 573..593 CDD:275368 9/20 (45%)
C2H2 Zn finger 601..621 CDD:275368 7/19 (37%)
C2H2 Zn finger 629..649 CDD:275368 7/19 (37%)
C2H2 Zn finger 657..677 CDD:275368 8/20 (40%)
C2H2 Zn finger 685..705 CDD:275368
C2H2 Zn finger 713..733 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.