DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and ZNF747

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001291947.1 Gene:ZNF747 / 65988 HGNCID:28350 Length:331 Species:Homo sapiens


Alignment Length:115 Identity:33/115 - (28%)
Similarity:55/115 - (47%) Gaps:4/115 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 DKSFVCEICSRSFAFGNQLAIHKRTHDEKHVAKPFVCEFCGKCFKQKIQMTTHVTAVHTKIRAFK 495
            |:...|.:|.:|||:.:.|..|..:|..:   |||.|..|||.|.....::.| .|:|...|..:
Human   179 DQRHGCYVCGKSFAWRSTLVEHIYSHRGE---KPFHCADCGKGFGHASSLSKH-RAIHRGERPHR 239

  Fly   496 CDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANALVKHRHIHK 545
            |..|.:.|:.:..|..|::.|...:...|..|.:.|.....:.||:.:|:
Human   240 CPECGRAFMRRTALTSHLRVHTGEKPYRCPQCGRCFGLKTGMAKHQWVHR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916
C2H2 Zn finger 377..398 CDD:275368
C2H2 Zn finger 408..429 CDD:275368
C2H2 Zn finger 436..456 CDD:275368 7/19 (37%)
C2H2 Zn finger 467..488 CDD:275368 7/20 (35%)
C2H2 Zn finger 496..516 CDD:275368 5/19 (26%)
C2H2 Zn finger 524..544 CDD:275368 5/19 (26%)
C2H2 Zn finger 551..572 CDD:275368
ZNF747NP_001291947.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
KRAB 37..96 CDD:214630
KRAB 37..76 CDD:279668
C2H2 Zn finger 184..204 CDD:275368 7/19 (37%)
zf-H2C2_2 197..219 CDD:290200 10/24 (42%)
C2H2 Zn finger 212..232 CDD:275368 7/20 (35%)
zf-H2C2_2 224..247 CDD:290200 6/23 (26%)
COG5048 236..>273 CDD:227381 9/36 (25%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
zf-H2C2_2 252..275 CDD:290200 5/22 (23%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.