DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and ZNF302

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_016882467.1 Gene:ZNF302 / 55900 HGNCID:13848 Length:444 Species:Homo sapiens


Alignment Length:509 Identity:112/509 - (22%)
Similarity:183/509 - (35%) Gaps:129/509 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PENCLAEDMFVDVPPSSENDESTSPVEEEEEEDDEVDSSSMTVDCELGTRNSTHFAPLTKFNPTF 147
            |..||..:..|:...:.|.......:|.|.....:|..|.:.:|..                   
Human    13 PNGCLVSNCGVNKMSNEELVGQNHGMEGEACTGGDVTFSDVAIDFS------------------- 58

  Fly   148 YRRSPRITQFIELYKQQTCLWDPADESYRD--KEKRANAYEELLEQLKATVNLHLTAYKLKKCIT 210
                         :::..||    |.:.||  |:.....||.|:    :...|.:|         
Human    59 -------------HEEWACL----DSAQRDLYKDVMVQNYENLV----SVAGLSVT--------- 93

  Fly   211 SLHAQYASISRQKKTQKLTKVPLYYHGKYSFLAERGSLEDADSDDVDGDGKIKLVFTEENQLTTQ 275
                            |...:.|...||..::.|:...:|.:|.            .|..:|:|:
Human    94 ----------------KPYVIMLLEDGKEPWMMEKKLSKDWESR------------WENKELSTK 130

  Fly   276 FIDLY---SKFPQLYDPAHK---HFCNLNVRKSSLIEIT--DLLTSEF-------------SLGL 319
             .|:|   |..|...:...|   .|.|.|..    :|.|  |...|.|             :.|.
Human   131 -KDIYDEDSPQPVTMEKVVKQSYEFSNSNKN----LEYTECDTFRSTFHSKSTLSEPQNNSAEGN 190

  Fly   320 VTHYDVYDSIQSMRQWY-SRRI---KTLTDVQCVGLSLAEKQYI---ERCNSFMPTKSFRQKL-K 376
            ...||:.....|.:... |.||   |.|.:....|.:..:.:.:   :.||        |:|: .
Human   191 SHKYDILKKNLSKKSVIKSERINGGKKLLNSNKSGAAFNQSKSLTLPQTCN--------REKIYT 247

  Fly   377 CEVCEHSFSTDHALQAHQFRDHKMGDGGWFRCTLCELNFDRKCHLQQHSQRVHMDKSFVCEICSR 441
            |..|..:|.....|..| :|.| .|:.. :.|..|...|.....|.:|......:|.:.|..|.:
Human   248 CSECGKAFGKQSILSRH-WRIH-TGEKP-YECRECGKTFSHGSSLTRHQISHSGEKPYKCIECGK 309

  Fly   442 SFAFGNQLAIHKRTHDEKHVAKPFVCEFCGKCFKQKIQMTTHVTAVHTKIRAFKCDMCPKDFLTK 506
            :|:.|:.|..|:.||..:   ||:.|..|||.|.:...:..|: .:||:.:.::|.:|.|.|:..
Human   310 AFSHGSSLTNHQSTHTGE---KPYECMNCGKSFSRVSLLIQHL-RIHTQEKRYECRICGKAFIHS 370

  Fly   507 RDLKDHVKAHLNIRDKVCEVCQKAFTNANALVKHRHIHK-EKTLQCSLCTTRFS 559
            ..|..|.|:|...:...|..|.|||..::.|.:|:.||. :|..:|:.|...||
Human   371 SSLIHHQKSHTGEKPYECRECGKAFCCSSHLTQHQRIHSMKKKYECNKCLKVFS 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 15/86 (17%)
GT1 276..>341 CDD:304916 20/89 (22%)
C2H2 Zn finger 377..398 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..429 CDD:275368 5/20 (25%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)
C2H2 Zn finger 467..488 CDD:275368 6/20 (30%)
C2H2 Zn finger 496..516 CDD:275368 7/19 (37%)
C2H2 Zn finger 524..544 CDD:275368 7/19 (37%)
C2H2 Zn finger 551..572 CDD:275368 4/9 (44%)
ZNF302XP_016882467.1 KRAB 48..109 CDD:214630 18/125 (14%)
COG5048 <151..393 CDD:227381 64/260 (25%)
C2H2 Zn finger 248..268 CDD:275368 6/20 (30%)
C2H2 Zn finger 276..296 CDD:275368 5/19 (26%)
C2H2 Zn finger 304..324 CDD:275368 6/19 (32%)
C2H2 Zn finger 332..352 CDD:275368 6/20 (30%)
C2H2 Zn finger 360..380 CDD:275368 7/19 (37%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
C2H2 Zn finger 416..436 CDD:275368 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.