DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and Sry-beta

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster


Alignment Length:249 Identity:56/249 - (22%)
Similarity:92/249 - (36%) Gaps:46/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 VQCVGLSLAEKQYIE--RCNSFMPTKSFRQ-----------------------KLKCEVCEHSFS 385
            ||...|...|:|..|  .|..||..:...:                       ::.|.:|...||
  Fly   117 VQATALKEPERQPGEEDECEEFMKEEMLDEEFQFSEPDDSMPSSEEEFFTETTEIPCHICGEMFS 181

  Fly   386 TDHALQAHQFRD--HKMGDGGWFRCTLCELNFD----RKCHLQQHSQRVHMDKSFVCEICSRSFA 444
            :...|:.|...|  .|....   .|.:|.|...    ...|:..|..:..::    |..|.:.|:
  Fly   182 SQEVLERHIKADTCQKSEQA---TCNVCGLKVKDDEVLDLHMNLHEGKTELE----CRYCDKKFS 239

  Fly   445 FGNQLAIHKRTHDEKHVAKPFVCEFCGKCFKQKIQMTTHVTAVHTKIRAFKCDMCPKDFLTKRDL 509
            ....:..|...|.:|   |.:.|:.||:.|.....|..|:.....:..|..|::|.:.|.|||..
  Fly   240 HKRNVLRHMEVHWDK---KKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFKTKRTY 301

  Fly   510 KDHVKAHLNIRDKV-CEVCQKAFTNANALVKHRHIH----KEKTLQCSLCTTRF 558
            |.|::.|...|.:. |..|:|:|.:...|..|:.:|    |.::.:....|..|
  Fly   302 KHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKRVHQPVEKPESAEAKEATVTF 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916
C2H2 Zn finger 377..398 CDD:275368 7/22 (32%)
C2H2 Zn finger 408..429 CDD:275368 5/24 (21%)
C2H2 Zn finger 436..456 CDD:275368 4/19 (21%)
C2H2 Zn finger 467..488 CDD:275368 6/20 (30%)
C2H2 Zn finger 496..516 CDD:275368 8/19 (42%)
C2H2 Zn finger 524..544 CDD:275368 6/19 (32%)
C2H2 Zn finger 551..572 CDD:275368 2/8 (25%)
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 4/19 (21%)
C2H2 Zn finger 231..251 CDD:275368 4/19 (21%)
C2H2 Zn finger 259..308 CDD:275368 15/48 (31%)
C2H2 Zn finger 288..303 CDD:275370 6/14 (43%)
zf-C2H2 315..337 CDD:278523 6/21 (29%)
C2H2 Zn finger 317..337 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.