DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and CG4424

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster


Alignment Length:141 Identity:45/141 - (31%)
Similarity:68/141 - (48%) Gaps:8/141 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 CTLCELNFDRKCHLQQHSQRVHMDKSFVCEICSRSFAFGNQLAIHKRTHDEKHVAKPFVCEFCGK 472
            |.:|...:.||..|..|.:|.:.::.:.||||.:||....||..|.|.|..   |||:.|::|.:
  Fly   189 CAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQHTG---AKPYTCQYCQR 250

  Fly   473 CFKQKIQMTTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANAL 537
            .|..:..:..| ...|...|.:.|..|.|.|.....||.|.|.|...:..:|::|.|:|...:.|
  Fly   251 NFADRTSLVKH-ERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNL 314

  Fly   538 VKH----RHIH 544
            |.|    :||:
  Fly   315 VAHLQTQQHIN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916
C2H2 Zn finger 377..398 CDD:275368
C2H2 Zn finger 408..429 CDD:275368 7/20 (35%)
C2H2 Zn finger 436..456 CDD:275368 10/19 (53%)
C2H2 Zn finger 467..488 CDD:275368 4/20 (20%)
C2H2 Zn finger 496..516 CDD:275368 8/19 (42%)
C2H2 Zn finger 524..544 CDD:275368 8/23 (35%)
C2H2 Zn finger 551..572 CDD:275368
CG4424NP_650859.3 zf-AD 10..92 CDD:285071
C2H2 Zn finger 189..209 CDD:275368 6/19 (32%)
DUF45 <204..281 CDD:302795 25/80 (31%)
COG5048 210..>345 CDD:227381 38/120 (32%)
C2H2 Zn finger 217..237 CDD:275368 10/19 (53%)
C2H2 Zn finger 245..265 CDD:275368 4/20 (20%)
zf-H2C2_2 257..282 CDD:290200 7/25 (28%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 9/23 (39%)
C2H2 Zn finger 301..320 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.