DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and CG3281

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster


Alignment Length:416 Identity:98/416 - (23%)
Similarity:148/416 - (35%) Gaps:121/416 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 LYYHG--KYSFL-AERGSLEDADSDDVDGDGKIKLVFTEEN-------QLTTQFIDLYSKFPQLY 287
            ||.|.  ||:.| .|...|.:|.|       |:|..:|:.|       ....:.|..| :|....
  Fly    26 LYVHDEIKYNDLKLELWQLLEAVS-------KLKWTWTDPNLPMHLCQNCARRLIGAY-EFIVEV 82

  Fly   288 DPAHKHFCNLNVRKSSLIEITDLLTSEFSLGLVTHYDV-----YDSIQSMRQWYSRRIKTLTDVQ 347
            :.||:...||..::....:..::           |.||     .|.:.||.|:.|      |...
  Fly    83 ENAHETLQNLFEQQEVAAKPDEV-----------HVDVVELIDQDDVVSMAQYLS------TSFA 130

  Fly   348 CVGLSLAEKQYIERCNSFM-----------------PTKSFRQK--------------------- 374
            ...:.:.||...:.|::|.                 |..||:.|                     
  Fly   131 EQHVEMEEKYGDQDCSAFTSDVGEEPLYASEDRDDEPEDSFQLKPRPDEIENRELSRPSQLGSRL 195

  Fly   375 -------LKCEVCEHSFSTDHALQAHQFRDHKMG-------------DGGWFRCTLCELNFDRKC 419
                   .||.||...|:...:|..|..:.||:.             ..|...|..|...|.|:.
  Fly   196 NHSANFIYKCAVCPRVFAKSESLTRHFSQAHKLTADVAAMKLANESCGTGLLTCEHCPRTFKRQD 260

  Fly   420 HLQQHSQRVHMDKSFVCEICSRSFAFGNQLAIH-KRTHD---EKHVAKPFVCEFCGKCFKQKIQM 480
            .|::|.|..|.|                .:|:. :.|.|   .|.:||...|..||..|... .:
  Fly   261 TLRRHMQAFHPD----------------AIALEPEETTDNSARKRIAKRRDCPHCGLSFPVS-SL 308

  Fly   481 TTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANALVKHRHIHK 545
            |.|:.. ||....:|||.|.|.|...:||..|::.|...|...|::|.|.|.:.|.|.:|..:|.
  Fly   309 TIHIRR-HTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRLHT 372

  Fly   546 -EKTLQCSLCTTRFSERVSLGVHMRR 570
             ::...|.:|:..|.:...|.:||||
  Fly   373 GQRPYSCKMCSKSFVQSNDLKIHMRR 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 5/10 (50%)
GT1 276..>341 CDD:304916 15/69 (22%)
C2H2 Zn finger 377..398 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..429 CDD:275368 7/20 (35%)
C2H2 Zn finger 436..456 CDD:275368 1/20 (5%)
C2H2 Zn finger 467..488 CDD:275368 6/20 (30%)
C2H2 Zn finger 496..516 CDD:275368 8/19 (42%)
C2H2 Zn finger 524..544 CDD:275368 7/19 (37%)
C2H2 Zn finger 551..572 CDD:275368 8/20 (40%)
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 19/73 (26%)
C2H2 Zn finger 205..226 CDD:275368 6/20 (30%)
C2H2 Zn finger 249..266 CDD:275368 5/16 (31%)
COG5048 <294..>391 CDD:227381 30/98 (31%)
C2H2 Zn finger 296..315 CDD:275368 6/20 (30%)
zf-H2C2_2 307..330 CDD:290200 9/23 (39%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
zf-H2C2_2 335..358 CDD:290200 8/22 (36%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-H2C2_2 364..388 CDD:290200 6/23 (26%)
C2H2 Zn finger 379..399 CDD:275368 8/20 (40%)
zf-H2C2_2 391..416 CDD:290200 5/8 (63%)
C2H2 Zn finger 407..424 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.