DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and CG6791

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster


Alignment Length:717 Identity:132/717 - (18%)
Similarity:232/717 - (32%) Gaps:240/717 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LARNNFEHFVLACAHQNDCYV-EMEFKRWREFIVHVK-EHLEANPSMQQELTTSEVISSAKCEEE 70
            |.::.|.|....|   ..||: :.|:|..::.:||:: .|.:            ||::..:....
  Fly   223 LLKHKFTHLPFRC---TKCYICKREYKYRQDLMVHLRMVHCD------------EVVAMMREGYN 272

  Fly    71 VSPAKVFIVEEPPENCLAEDMFVDVPPSSEND---ESTSPVEEEEE----EDDEVDSSSMTVDCE 128
            .:..|..:.|...|..|.|..|      .|||   |.:..:|...|    :.||..:...||..|
  Fly   273 AAGRKTRVRESRTEQLLREKSF------RENDDLGEESDRIEVRNELLEPDADESGTQEQTVSEE 331

  Fly   129 L-----GTRNSTHFAPLTKFNPTFYRRSPRITQFIELYKQQTC-----------LWDPADESYRD 177
            :     |||.:                    .:..|.|....|           .|....|...|
  Fly   332 VSKKKAGTRGA--------------------AELCEDYIHYMCPDCGTDCDTHAQWSQHIEFVHD 376

  Fly   178 KEKRANAYEELLEQLKATVNLHLTAYKLKKCIT-----SLHA-QYASISRQK------------K 224
            ...|......       :|::.:...:.||.:|     ||.| :::.:|:.:            .
  Fly   377 YVSRRGLNFR-------SVDMQMQCLECKKIVTPNTIKSLRAHKFSHLSQPEWLRCKLCYKGYTD 434

  Fly   225 TQKLTKVPLYYHGKYSFLAERGSLEDADS-----DDVDGD---GKIKLVFTEENQLTTQFIDLYS 281
            .|::.:..|..|...:.::|....||.|:     |:.|||   |:......:|:.          
  Fly   435 HQEIIRHLLQQHHMDTLMSEDAEEEDGDAPSAIEDECDGDNGNGEGNGAPLDEDS---------- 489

  Fly   282 KFPQLYDPAHKHFCNLNVRKSSLIEITDLLTSEFSLGLVTHYDVYDSIQSMRQWYSRRIKTLTDV 346
              |...|..         |:...|...|:..        .|.| |...|..:::..::......|
  Fly   490 --PYFEDAP---------RRGGRISSDDIFE--------PHID-YLCPQCGKEFIEKKHWRTHVV 534

  Fly   347 QCVGLSLAEKQYIERCNSFMPTKSFRQKLKCEVCEHSFSTDHALQ-AHQFRDHKMGDGGWFRCTL 410
            ....::...|...|..|        .::|||..|:...:..:.:| |.|.|...:....:.||..
  Fly   535 MAHSMNDLSKLNFEMIN--------ERQLKCTECDKIITNAYGIQNAQQHRITHLPFKAYARCRK 591

  Fly   411 CELNF-DRK---CHLQQHSQRVHMDKSF------------------VCEICSRSFA--------- 444
            |..:: |||   .||..| .||...:..                  :..:.:.::.         
  Fly   592 CHKSYTDRKGLVKHLATH-HRVGWPRKLSGGCPAPILTPAKQPRKQIVTVANETYEIIYLDDVDQ 655

  Fly   445 --------FGNQLAIHKRTHDEKHVAKP------------------FVCEFCGKCFKQKIQMTTH 483
                    ||.|:   :...||..:|.|                  :.|..||..|..:..:..|
  Fly   656 GGMEEDNDFGEQM---QAEEDEYPIAPPPPSPPPPPQPTTQGNHQRYKCVHCGTLFATQAAVRVH 717

  Fly   484 VTAVH---TKIR---------------------AFKCDMCPKDFLTKRDLKDHV--------KAH 516
            ::...   |.:|                     .|.|..|..::.|:.:.:.|:        :.:
  Fly   718 ISEKRCRKTVVRRRRQPVMSSADPSVPTVEQNYIFLCPSCGFEYKTQFEWRRHINEVHNFDKRQY 782

  Fly   517 LNIR--DKV---CEVCQKAFTNA--NALVKH--RHIHKEKTLQCSLCTTRFSERVSLGVHMRRTH 572
            ||:|  ||.   |..|:....|:  ..|..|  ||:.....|:|.:|.|.::.:.::..|:|..|
  Fly   783 LNMRQLDKYRYQCTQCKDIVCNSKLKGLQDHHFRHLPYRLYLKCLICGTCYNHKPNIAAHLRARH 847

  Fly   573 KI 574
            .|
  Fly   848 SI 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 18/113 (16%)
GT1 276..>341 CDD:304916 9/64 (14%)
C2H2 Zn finger 377..398 CDD:275368 6/21 (29%)
C2H2 Zn finger 408..429 CDD:275368 9/24 (38%)
C2H2 Zn finger 436..456 CDD:275368 3/36 (8%)
C2H2 Zn finger 467..488 CDD:275368 5/20 (25%)
C2H2 Zn finger 496..516 CDD:275368 4/27 (15%)
C2H2 Zn finger 524..544 CDD:275368 7/23 (30%)
C2H2 Zn finger 551..572 CDD:275368 5/20 (25%)
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368 2/6 (33%)
C2H2 Zn finger 235..256 CDD:275368 7/23 (30%)
C2H2 Zn finger 516..532 CDD:275368 1/15 (7%)
C2H2 Zn finger 557..580 CDD:275368 6/22 (27%)
C2H2 Zn finger 589..609 CDD:275368 7/19 (37%)
COG5236 <939..>1096 CDD:227561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440043
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.