DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and CG2678

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster


Alignment Length:527 Identity:113/527 - (21%)
Similarity:172/527 - (32%) Gaps:169/527 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 CLAE-----DMFVDV--PPSSENDESTSPV----EEEEEEDDEVDSSSMTVDCELGTRNSTHFAP 139
            |:.|     |:|.:|  |...|.:.|.|.:    .|...:..::....:.|.|.|..:|:..|. 
  Fly    12 CMDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGDLLPQFICVSCVLAVQNAFRFK- 75

  Fly   140 LTKFNPTFYRRSPRITQFIELYKQQTCLWDPADESYRDKEKRANAYEELLEQLKATVN-LHLTAY 203
                                        |. :::||:.       :..:|.|..|..| :||.|.
  Fly    76 ----------------------------WQ-SEQSYQH-------FFRVLNQSGAPENQVHLAAC 104

  Fly   204 K-LKKCITSLHAQYASISRQKKTQKLTKVPLYYHGKYSFLAERGSLEDADSDDVDGDGKIKLVFT 267
            . .|..|.:...|..| .||:.||::||.                  ....||:.....::....
  Fly   105 NGDKNQIINQKMQLKS-DRQQDTQQMTKT------------------QKPDDDLSQKQTLQAKLQ 150

  Fly   268 EENQLTTQFIDLYSKFPQLYDPAHKHFCNLNVRKSSLIEITDLLTSEF--SLGLVTHYDVYDSIQ 330
            |.|      ||         .|......:...|.....|..|::..|.  |..::...|.|.:..
  Fly   151 EGN------ID---------GPPESFTLHPRKRTCRTEEQADMIPKEATRSTKMICDADGYYNCP 200

  Fly   331 --SMRQWYSRRIKT-LTDVQCVGLSLAEKQYIERCNSFMPTKSFRQKLKCEVCEHSFSTDHALQA 392
              |.|.....:::| :||:               ||            :|..|..::.....|:.
  Fly   201 HCSKRFCSQTQLRTHITDL---------------CN------------RCPYCPRTYMQKSNLKR 238

  Fly   393 HQFRDHKMGDGGWFRCTLCELNFDRKCHLQQHSQRVHMDKSFVCEICSRSFAFGNQLAIHKRTH- 456
            | .|:|.....  .:|..|...|.||.||::|.:....|....|..||..|....||.||:|.| 
  Fly   239 H-LRNHLSKPA--HKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRREHK 300

  Fly   457 -------------------DEKHVAKPF--------------------VCEFCGKCFKQ----KI 478
                               |:....||.                    :|:.|.|.|..    |.
  Fly   301 QRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKPICDICQKKFSSVYALKR 365

  Fly   479 QMTTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANALVKH-RH 542
            .|.||....|.|    ||..|.::|.|::.||.|.:.|:....: ||.|...|.:.|.|.|| :.
  Fly   366 HMLTHNRQHHLK----KCTYCSEEFKTEKHLKRHERGHMGDLFR-CEFCSLVFVDVNYLRKHKKR 425

  Fly   543 IHKEKTL 549
            ||....:
  Fly   426 IHSNNVI 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 20/86 (23%)
GT1 276..>341 CDD:304916 12/68 (18%)
C2H2 Zn finger 377..398 CDD:275368 5/20 (25%)
C2H2 Zn finger 408..429 CDD:275368 8/20 (40%)
C2H2 Zn finger 436..456 CDD:275368 9/19 (47%)
C2H2 Zn finger 467..488 CDD:275368 8/24 (33%)
C2H2 Zn finger 496..516 CDD:275368 7/19 (37%)
C2H2 Zn finger 524..544 CDD:275368 8/20 (40%)
C2H2 Zn finger 551..572 CDD:275368
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 18/109 (17%)
COG5048 220..>284 CDD:227381 19/78 (24%)
C2H2 Zn finger 223..243 CDD:275368 5/20 (25%)
zf-C2H2 249..271 CDD:278523 8/21 (38%)
C2H2 Zn finger 251..271 CDD:275368 8/19 (42%)
C2H2 Zn finger 279..299 CDD:275368 9/19 (47%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..427 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.