DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment az2 and CG1024

DIOPT Version :9

Sequence 1:	NP_610289.2	Gene:	az2 / 35682	FlyBaseID:	FBgn0025185	Length:	593	Species:	Drosophila melanogaster
Sequence 2:	NP_001138014.2	Gene:	CG1024 / 40789	FlyBaseID:	FBgn0027514	Length:	543	Species:	Drosophila melanogaster

Alignment Length:	121	Identity:	31/121 - (25%)
Similarity:	55/121 - (45%)	Gaps:	22/121 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   458 EKHVAKPFVCEFCGKCFKQKIQMTTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDK 522
            |.|:.  ::|..|||.|:.:.:...|:...|             |:| |:...|.....::.|..
  Fly    23 EAHMV--YICPECGKAFRTQAEWRQHLNTKH-------------DYL-KKTYSDFNFIQIDERFH 71

  Fly   523 VCEVCQKAFTNAN---ALVKHR---HIHKEKTLQCSLCTTRFSERVSLGVHMRRTH 572
            .|::|.|...||:   ||:::.   |:...:|.:|..|...::.|.:|.||:..||
  Fly    72 ECQLCFKWVENAHKTIALLQYHYFMHLEHSETYRCVHCRMAYTRRRALNVHLLDTH 127

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
az2	NP_610289.2	MADF_DNA_bdg	157..242	CDD:287510
		GT1	276..>341	CDD:304916
		C2H2 Zn finger	377..398	CDD:275368
		C2H2 Zn finger	408..429	CDD:275368
		C2H2 Zn finger	436..456	CDD:275368
		C2H2 Zn finger	467..488	CDD:275368	6/20 (30%)
		C2H2 Zn finger	496..516	CDD:275368	4/19 (21%)
		C2H2 Zn finger	524..544	CDD:275368	8/25 (32%)
		C2H2 Zn finger	551..572	CDD:275368	6/20 (30%)
CG1024	NP_001138014.2	C2H2 Zn finger	30..51	CDD:275368	6/20 (30%)
		C2H2 Zn finger	73..100	CDD:275368	8/26 (31%)
		C2H2 Zn finger	106..123	CDD:275368	5/16 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24409
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100