DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and CG10654

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:281 Identity:67/281 - (23%)
Similarity:113/281 - (40%) Gaps:62/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 LLTSEFSLGLVTHYDVY---DSIQSMRQWYSRRIKTLTDVQCVGLSLAEKQYIERCNSFMPTKSF 371
            ::.|..:||.....:||   |  :|.:|          |:....||::.|....|     ..:..
  Fly   175 VILSRITLGASLEEEVYVIED--ESAKQ----------DLGQEKLSISSKLLGAR-----KRRGV 222

  Fly   372 RQKLKCEVCEHSFSTDHALQAHQFRDHKMGDGGWFRCTLCELNFDRKCHLQQHSQRVHMDKS--- 433
            |..|:|.:|...|.....|:||..:...:..   :.|..|..::.|...|:.|.:::|.:..   
  Fly   223 RHTLECRICHRGFYKPSLLEAHMQQHEGLRP---YTCVHCAKSYARANLLESHLRQMHNNADAAR 284

  Fly   434 --FVCEICSRSFAFGNQLAIH-KRTHDEKHVAKP----FVCEFCGKCFKQKIQMTTHVTAVHTKI 491
              :.|..|::.:.....|..| :|||:..|.::.    .:||.|||||.:|..:|.| ..||..:
  Fly   285 IIYACPSCNKVYTANRSLKYHMRRTHERYHESESPDARHICEECGKCFARKAHLTRH-KMVHGSV 348

  Fly   492 --RAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANALVKHRHIHKEKTLQCSLC 554
              |.:.|:.|.:.|.||.::.||                         :..:|.:|...|:|..|
  Fly   349 EGRRYCCECCDRRFYTKENMVDH-------------------------LLRKHGNKNLLLRCRKC 388

  Fly   555 TTRFSERVSLGVHMRRTHKIL 575
            ...|...|.|..|.|: ||.:
  Fly   389 GRIFQNSVELNAHGRK-HKAM 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916 8/33 (24%)
C2H2 Zn finger 377..398 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..429 CDD:275368 5/20 (25%)
C2H2 Zn finger 436..456 CDD:275368 5/20 (25%)
C2H2 Zn finger 467..488 CDD:275368 10/20 (50%)
C2H2 Zn finger 496..516 CDD:275368 7/19 (37%)
C2H2 Zn finger 524..544 CDD:275368 1/19 (5%)
C2H2 Zn finger 551..572 CDD:275368 7/20 (35%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
C2H2 Zn finger 256..313 CDD:275368 13/56 (23%)
C2H2 Zn finger 289..314 CDD:275368 7/24 (29%)
zf-C2H2 323..345 CDD:278523 10/22 (45%)
C2H2 Zn finger 325..345 CDD:275368 10/20 (50%)
C2H2 Zn finger 355..376 CDD:275368 7/45 (16%)
C2H2 Zn finger 385..405 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440003
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.