DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and CG2199

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster


Alignment Length:715 Identity:118/715 - (16%)
Similarity:214/715 - (29%) Gaps:249/715 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TSEVISSAKCEEEVSPAKVFIVEEPPENCLAEDMFVDVPPSSENDESTSPVEEEEEEDDEVDSSS 122
            ||..:|||...|:|......:.|:|.                   :.|...|.||....|.|..:
  Fly    68 TSTFMSSAALIEKVRETVDRVQEQPA-------------------KKTKVAEIEEPSTQESDKKA 113

  Fly   123 MTVDCELGTRNST---HFAPLTKFNPTFYRRSPRITQFIELY------------KQQTCLWD--- 169
            :.|.    .:|:|   ....:..|.|:|...:...|: ||:.            ||.:.|::   
  Fly   114 VKVP----KKNTTLRQRSKSIAAFPPSFVNGANTNTE-IEIISASPKKLDKTPKKQISRLFEDNL 173

  Fly   170 -------PADESYRDKEKRANAY--------------EELLEQLKATVNLHLTAYKLKKCITSLH 213
                   ||.|....|:...|.:              ||..:..|..:.::...::..:|  ..|
  Fly   174 NDSVKLTPAKEVSSTKKAFLNLFGNGGNDAIEVLTESEEEEDSDKGPITINTNNFQCPEC--EFH 236

  Fly   214 AQYASISRQ--KKTQKLTKVPLY-------YHGKYSFLAERGSLEDADSDDVDGDGKIKLVFTEE 269
            |::....::  :|...|.:..:|       ..|....|  :..|.|..|...:.:.|.|...::|
  Fly   237 AKFPKPYKEHLQKEHGLQRPRIYPCTLCIKTFGVLKTL--KNHLRDTHSRTFESEAKTKAKESKE 299

  Fly   270 NQLTT---QFIDLYSK----FPQLYDPAHKHF--------CNLNVRKSSLIEITDLLTSEFSLGL 319
            .:..:   ..||..:|    ..|...|..|..        ||:..:      :.|.:..:.:...
  Fly   300 KEAKSGAKNKIDAKAKETNAVSQRKKPKEKKSKEKKTEIKCNVETK------VVDEIDDQVNNKK 358

  Fly   320 VTHYDVYDSIQSMRQWYSRRIKTLTDVQCVGLSLAEKQYIERC-----------NSFMPTKSFRQ 373
            .|..:..|..|:.:         :...:.:..||.:|:.:|..           :|....::...
  Fly   359 GTDSEDADQTQATK---------IASFKALNESLMKKRMLENVIDSEYTFAINGSSASTPRADSN 414

  Fly   374 KLKCEVCEHSFSTDHALQAHQFRDHKMGDGGWFRCTLCELNFDRKCHLQQH-------------- 424
            ..:||:|:....|...:|.|....|.:.....|:|.:||.:...|..|:.|              
  Fly   415 NFQCEICDCELMTAKQMQEHMKTVHSIDKPKVFKCHVCEKSLATKQSLKTHMTLHADGAEAPNSS 479

  Fly   425 --------------------------------------------SQRVHMDKSFVCEICSRSFAF 445
                                                        ::::..::..|.||.. :|..
  Fly   480 KRKILQDEDEDVDILGTTQIENTAEKVEGPKKSQQSPTKAAKFTNRKILQEEDEVVEIVD-AFKT 543

  Fly   446 GN----------QLAIHKRTHDEKHVAKPFVCEFCGKCFKQKIQMTTHV---------------- 484
            .|          :..|..|.:.:..|....:..   :...:|.:.|:||                
  Fly   544 DNTAEDDEGPAEEKIIRSRNNIQHQVDGGMIAP---RSPAKKTKKTSHVDLSVSTTNGNSPAKSE 605

  Fly   485 --------------------------TAVHTKIR------------AFKCDMCPKDFLTKRDLKD 511
                                      ...|.|.|            ...||.|.|...:::.|..
  Fly   606 KRKKQDKSEDTLPSSDVDIVEEINYNVRPHKKARLESIGDSTADESTLSCDRCGKFVKSRQRLDS 670

  Fly   512 HV-KAHLNIRDKVCEVCQKAFTNANALVKH-RHIHKEKTLQCSL--CTTRFSERVSLGVHMRRTH 572
            |: |.|  .....|.:|::.:.|....|.| .:...|..|.|.:  |...|:|...|..|:|:.|
  Fly   671 HMEKKH--AAKLQCTLCKEVYQNQMDYVAHFSNCGSEGGLPCGVANCKKVFTEANFLSSHLRKRH 733

  Fly   573  572
              Fly   734  733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 20/129 (16%)
GT1 276..>341 CDD:304916 12/76 (16%)
C2H2 Zn finger 377..398 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..429 CDD:275368 6/78 (8%)
C2H2 Zn finger 436..456 CDD:275368 6/29 (21%)
C2H2 Zn finger 467..488 CDD:275368 4/62 (6%)
C2H2 Zn finger 496..516 CDD:275368 7/20 (35%)
C2H2 Zn finger 524..544 CDD:275368 5/20 (25%)
C2H2 Zn finger 551..572 CDD:275368 7/22 (32%)
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 6/20 (30%)
C2H2 Zn finger 449..469 CDD:275370 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457885
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.