DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and CG1603

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster


Alignment Length:604 Identity:187/604 - (30%)
Similarity:288/604 - (47%) Gaps:75/604 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVVCGNILARNNFEHFVLACAHQNDCYVEMEFKRWREFIVHVK-------EHLEANPSMQQELTT 58
            |.:|||::..:.:|.|.|.|.:   |.:|.|.|.|..||||||       |.:..|...:.....
  Fly     1 MELCGNVMTNSKYEMFRLKCLY---CSIESELKDWELFIVHVKSAHYCEDEDVRINEIKEDTEEL 62

  Fly    59 SEVISSAKCEEEVSPAKVFIVEEPPENCLAEDMF------------------------------- 92
            ..|:.:|.......|.:.|   |..||....|.:                               
  Fly    63 YSVVDAADPAIAYGPDEFF---EVIENSNGVDQWMEADSKDIQYEEDATAWSAATNNSWEFGPGG 124

  Fly    93 --VDVPPSSE---NDESTSPVEEEEEEDDEVDSSS--MTVDCELGTR------NSTHFAPLTKFN 144
              :::|...|   .|||:........:||:||.|.  |:.|.....|      ..|....:.||.
  Fly   125 SSLELPAGKEVTQMDESSQNHIPLNTDDDDVDCSDFFMSEDDLAPPRKPGRPPRRTRPGQVFKFK 189

  Fly   145 PTFYRRSPRITQFIELYKQQTCLWDPADESYRDKEKRANAYEELLEQLKATVNLHLTAYKLKKCI 209
            .:|.|.:||:...|:.||:..|||:|:||.|:|:..|:.|||.::|::....|:..|..:|||.:
  Fly   190 VSFIRSNPRVLHLIQAYKEHPCLWNPSDEHYQDEPARSMAYEAIMERMDRKANVLFTVEELKKTL 254

  Fly   210 TSLHAQYASISRQKKTQKLTKVPLYYHGKYSFLAERGSLEDADSDDVDGDGKIKLVFTEENQLTT 274
            ..||.||......|:..||..:...|..|..||:....:...::::.:....|||.|.|||.:||
  Fly   255 EQLHVQYTLALETKQRGKLVGLAARYFAKCEFLSVAPVVTPRENEEDNDLTAIKLNFKEENLITT 319

  Fly   275 QFIDLYSKFPQLYDPAHKHFCNLNVRKSSLIEITDLLTSEFS-LGLVTHYDVYDSIQSMRQW-YS 337
            .||:.|:.:|.||:.|...|.::.:|..:.    ..:..||. :......|||.::..:|:| |.
  Fly   320 SFIETYANYPVLYNQALPDFGSIEIRADAF----KRMAKEFQPVVKANETDVYIAVNKLRRWLYD 380

  Fly   338 --RRIKTLTDVQ-CVGLSLAEKQYIERCNSFMPTK-SFRQKLKCEVCEHSFSTDHALQAHQFRDH 398
              ||:|:...:| |   |..|.||::.| ||:|.| |..|.|.|:.|:..|..|:.|:.|..:.|
  Fly   381 AIRRLKSKELIQKC---SKQEVQYLQMC-SFLPAKGSESQVLYCDYCDKRFHGDYNLRVHIVKAH 441

  Fly   399 KMGDGGWFRCTLCELNFDRKCHLQQHSQRVHMDKSFVCEICSRSFAFGNQLAIHKRTHDEKHVAK 463
            ::||..:. |:.|...|||...:.:|..|.|.::...|:.|.:|||....|.:|...|..:   :
  Fly   442 EVGDLPYL-CSFCPRRFDRHVDMDRHKLRSHFERKLKCQYCEKSFAVDTDLKVHTLIHTGE---R 502

  Fly   464 PFVCEFCGKCFKQKIQMTTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQ 528
            |.||:.|||.|:.|:.:..||..||..||.:.|:||.|.|..|.:|.:|:|.|||||||.||.|.
  Fly   503 PHVCDICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKKCEYCD 567

  Fly   529 KAFTNANALVKHRHIHKEK 547
            ..|.:.::|.:||..|:.:
  Fly   568 ATFYDHSSLSRHRRSHRSE 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 30/84 (36%)
GT1 276..>341 CDD:304916 19/68 (28%)
C2H2 Zn finger 377..398 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..429 CDD:275368 7/20 (35%)
C2H2 Zn finger 436..456 CDD:275368 7/19 (37%)
C2H2 Zn finger 467..488 CDD:275368 8/20 (40%)
C2H2 Zn finger 496..516 CDD:275368 9/19 (47%)
C2H2 Zn finger 524..544 CDD:275368 7/19 (37%)
C2H2 Zn finger 551..572 CDD:275368
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510 30/84 (36%)
GT1 321..408 CDD:304916 28/94 (30%)
C2H2 Zn finger 420..441 CDD:275368 6/20 (30%)
COG5048 <424..583 CDD:227381 60/162 (37%)
C2H2 Zn finger 450..471 CDD:275368 7/20 (35%)
C2H2 Zn finger 478..498 CDD:275368 7/19 (37%)
zf-H2C2_2 490..513 CDD:290200 9/25 (36%)
C2H2 Zn finger 506..527 CDD:275368 8/20 (40%)
C2H2 Zn finger 535..555 CDD:275368 9/19 (47%)
C2H2 Zn finger 563..583 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C61I
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I3519
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012671
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.