DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and CG31612

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster


Alignment Length:737 Identity:141/737 - (19%)
Similarity:236/737 - (32%) Gaps:255/737 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SMQ-QELTTSEVISS------AKCEEEVSPAKVFIVEEPPENCLAEDMFV------DVPPSSEND 102
            |:| |.:.|...|.|      :|.|...:||...:::...||  .|.:|.      :.|.:|:.:
  Fly   119 SLQLQSVATGGKIGSVPRQERSKDESWSAPAGDPLLKAVREN--DETVFKPLHFDHEYPEASDEE 181

  Fly   103 ESTSPVEEEEEEDDEVDSSSMTVDCELGTRNSTHFAPLT----KFNPTFYRRSPRITQ-FIELYK 162
            :.....||.:.|:||.:..:        .|:|....|.:    |:.|   .:.|::.. .||...
  Fly   182 DDEDEHEEFDAEEDEEEYDA--------RRHSPPIVPASHTGGKWKP---EQRPQLRHPHIERLS 235

  Fly   163 QQTCLWD-PADESY----------------RDKEKRANAYEELLEQ-------------LKATV- 196
            ..   || |.:|:|                :..|.|.|.....|:|             ||:.: 
  Fly   236 PS---WDEPPEENYTHPPADHTKGKWVPGSKQLEYRENLDLTKLDQPGASYWCNICCRRLKSRLY 297

  Fly   197 -NLHL-TAYKLKKCITSLHAQYASISRQ-----------------------KKTQKLTKVPLYYH 236
             |.|| :.|.:|:.......:.|::.|:                       ::...|.:..|..|
  Fly   298 YNQHLRSGYHIKRAEAECELEQATLGRELTLSKDFSIKDDADKNEPKPPKRQRRANLLRCDLCRH 362

  Fly   237 -------GKY-------------SFLAERGSLEDADSDDVDGDGKIKLVFTEENQLTTQFID--L 279
                   ||:             |.:..:..|::.          :|.:.:...|...|.:.  .
  Fly   363 TMARHLIGKHLISHYHFRRLQQQSRIRRQACLQEI----------LKHMGSIVRQSPFQCMPCRF 417

  Fly   280 YSKFPQ--LYD-PAHKH--------------FC--NLNVRKSSLIEITDLLTSEFSLGLVTHYDV 325
            |:...:  ||. .:|:|              ||  |.|...|.|:.:.|....|..|.|  :..|
  Fly   418 YANTEETFLYHWKSHEHLELTKRLGGTFWCSFCQFNSNTNNSMLLHLLDSSHKEVLLAL--NRSV 480

  Fly   326 YDSIQSMRQWYSRR--IKTLTDVQCVGLSLAEKQYIERCNSFMPTKSFRQKLKCEVCEHSFSTDH 388
            ...|...|:....|  ::.|.::|....|:.|...:....:  ....::.:.:|.:|..|..:..
  Fly   481 PICIAQRRRIQCSRCGMEFLYNIQLRQHSITEHPGLALTGT--AADEYQSRFRCNLCGSSQKSRL 543

  Fly   389 ALQAHQFRDHKMGDGGWFRCTLCELNFDR------------------------------------ 417
            |||.|:...|.:..   :.|.:|.|.||.                                    
  Fly   544 ALQRHKKHKHHLAR---YFCAICRLEFDNSLDARRHRSLVIHKQKARPQTSIPQPENEIEHMLRE 605

  Fly   418 -------------------KC-----------HLQQHSQRVHMDKSFVCEICSRSFAFGNQLAIH 452
                               ||           .|.||...||...:.:|..|..||.....|..|
  Fly   606 VLEETVPSPPAKRSADVNAKCSNSRKTIESSQRLAQHQAEVHSSDNHLCLSCGISFESAQALGRH 670

  Fly   453 KRT----------HDEKHVAKP--FVCEFCGKCFKQKIQMTTHVTAVHT------KIRAFKCDMC 499
            .|:          .|.....|.  :.|:.|....:.:..:..| ...||      |....:|.:|
  Fly   671 TRSCQPLASTSTPADLSQAQKKSMYSCDQCRFQSQYESDLVYH-RIFHTRSGTIGKNEVLQCPLC 734

  Fly   500 PKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANALVKH---RHI---HKEK----------- 547
            ||:| .|..|:.|::.|.|.:...|..|.:.|...:.|..|   :|.   .|||           
  Fly   735 PKNF-KKHSLRAHLRNHTNEKIFECTECLQKFARRHNLKNHVITKHAKVGDKEKKKYAAKDVEQS 798

  Fly   548 --TLQCSLCTTRFSERVSLGVH 567
              ..||..|....:::.||.:|
  Fly   799 KPKYQCGTCGKLLAKKYSLKLH 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 27/160 (17%)
GT1 276..>341 CDD:304916 19/87 (22%)
C2H2 Zn finger 377..398 CDD:275368 7/20 (35%)
C2H2 Zn finger 408..429 CDD:275368 10/86 (12%)
C2H2 Zn finger 436..456 CDD:275368 7/29 (24%)
C2H2 Zn finger 467..488 CDD:275368 3/20 (15%)
C2H2 Zn finger 496..516 CDD:275368 8/19 (42%)
C2H2 Zn finger 524..544 CDD:275368 6/25 (24%)
C2H2 Zn finger 551..572 CDD:275368 5/17 (29%)
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 3/20 (15%)
C2H2 Zn finger 731..750 CDD:275368 8/19 (42%)
C2H2 Zn finger 758..779 CDD:275368 5/20 (25%)
C2H2 Zn finger 804..824 CDD:275368 5/17 (29%)
C2H2 Zn finger 834..856 CDD:275368
C2H2 Zn finger 898..918 CDD:275368
zf-H2C2_2 910..935 CDD:290200
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.