DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and CG12299

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster


Alignment Length:582 Identity:128/582 - (21%)
Similarity:201/582 - (34%) Gaps:214/582 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EFIVH----------VKEHLEANPSMQQELTTSEVISSAKCEEEVSPAKVFIVEEPPENCLAED- 90
            ||.||          :..|...|...:||....|       .|:.|    :|.|...|  |||| 
  Fly    55 EFFVHPLALYQHMNTLHPHEPGNGQQEQESPGDE-------SEDYS----WIFEPVCE--LAEDG 106

  Fly    91 -MFVDVPPSSENDESTSPVEEEEEEDDEVDSSSMTVDCELGTRNSTHFAPLTKFNPTFYRRSPRI 154
             ...|...||.:|.|:|..::::::||:..|||.:   ...:.:|:...|.|..:.|        
  Fly   107 SDSSDGSASSGSDSSSSSDDDDDDDDDDSSSSSSS---SSNSSSSSSSVPTTSNSNT-------- 160

  Fly   155 TQFIELYKQQTCLWDPADESYRDKEKRANAYEELLEQLKATVNLHLTAYKLKKCITSLHAQYASI 219
                    ||:                                                      
  Fly   161 --------QQS------------------------------------------------------ 163

  Fly   220 SRQKKTQKLTKVPLYYHGKYSFLAERGSLEDADSDDVDGDG--KIKLVFTEENQLTTQFI--DLY 280
              |:..|.|       ||.                 |.|.|  :.:|..|:..:.|:.|:  ...
  Fly   164 --QESVQPL-------HGL-----------------VAGPGYNEFQLQMTDPRESTSIFMVQPTV 202

  Fly   281 SKFP--QLYDPAHKHFCNLNVRKSSLIEITDLLTSEFSLGLVTHYDVYDSIQS--MRQWYSRRIK 341
            |..|  ||..||.                    |....|||          ||  :::...||..
  Fly   203 SVTPLQQLLPPAP--------------------TVSPGLGL----------QSTPIKRRRGRRSN 237

  Fly   342 TLTDVQCVGLSLAEKQYIERCNSFMPTKSFRQK-LKCEVCEHSFSTDHALQAHQFRDHKMGDGGW 405
                   :|..:.:           |..:..|| .:|..||.||.....|..| .|.|.....  
  Fly   238 -------IGAPVMD-----------PALNGNQKCFQCTHCEASFPNAGDLSKH-VRSHITNKP-- 281

  Fly   406 FRCTLCELNFDRKCHLQQHSQRVHM-DKSFVCEICSRSFAFGNQLAIHKRT-------------- 455
            |:|::|:..|.....|..|. |:|. :|.:.||:|.::|...:.|.:|.|:              
  Fly   282 FQCSICQKTFTHIGSLNTHI-RIHSGEKPYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDK 345

  Fly   456 ----------HDEKHVA--KPFVCEFCGKCFKQKIQMTTHVTAVHTKIRAFKCDMCPKDFLTKRD 508
                      |.:.|:|  :.|:|..|.:.||.:..:..|: .:||:...::|.:|.:.|....:
  Fly   346 GFINYSSLLLHQKTHIAPTETFICPECEREFKAEALLDEHM-RMHTQELVYQCAICREAFRASSE 409

  Fly   509 LKDHVKAHLNIRDKVCEVCQKAFTNANALVKHRHIHK-EKTLQCSLCTTRFSERVSLGVHMR 569
            |..|:|.|:..:...|.:|.::||.:.:|..|..||. ||..||.||...|::..||.|||:
  Fly   410 LVQHMKNHMGEKPFTCSLCDRSFTQSGSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMK 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 7/84 (8%)
GT1 276..>341 CDD:304916 15/70 (21%)
C2H2 Zn finger 377..398 CDD:275368 8/20 (40%)
C2H2 Zn finger 408..429 CDD:275368 6/20 (30%)
C2H2 Zn finger 436..456 CDD:275368 7/43 (16%)
C2H2 Zn finger 467..488 CDD:275368 5/20 (25%)
C2H2 Zn finger 496..516 CDD:275368 6/19 (32%)
C2H2 Zn finger 524..544 CDD:275368 6/19 (32%)
C2H2 Zn finger 551..572 CDD:275368 9/19 (47%)
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 40/163 (25%)
C2H2 Zn finger 256..276 CDD:275368 8/20 (40%)
zf-H2C2_2 268..293 CDD:290200 8/27 (30%)
C2H2 Zn finger 284..304 CDD:275368 6/20 (30%)
zf-H2C2_2 296..321 CDD:290200 9/25 (36%)
zf-C2H2_2 312..>387 CDD:289522 16/75 (21%)
C2H2 Zn finger 312..332 CDD:275368 7/19 (37%)
C2H2 Zn finger 340..360 CDD:275368 1/19 (5%)
C2H2 Zn finger 369..389 CDD:275368 5/20 (25%)
C2H2 Zn finger 397..417 CDD:275368 6/19 (32%)
zf-H2C2_2 409..434 CDD:290200 7/24 (29%)
C2H2 Zn finger 425..445 CDD:275368 6/19 (32%)
zf-H2C2_2 437..462 CDD:290200 11/24 (46%)
C2H2 Zn finger 453..473 CDD:275368 9/19 (47%)
zf-H2C2_2 465..490 CDD:290200 5/7 (71%)
C2H2 Zn finger 481..501 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.