DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and ZNF181

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:XP_016882229.1 Gene:ZNF181 / 339318 HGNCID:12971 Length:585 Species:Homo sapiens


Alignment Length:608 Identity:128/608 - (21%)
Similarity:215/608 - (35%) Gaps:172/608 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NDCYVEMEFKRWREFIVHVKEHLEANPSMQQ-ELTTSEVISSAKCEEEVSPAKVFIVEEPPENCL 87
            ||..::...:.| .::...:..|..:..:|. |...|..:|..|      |..:.::|:..|..:
Human    26 NDVAIDFTHEEW-GWLSSAQRDLYKDVMVQNYENLVSVGLSVTK------PYVITLLEDGKEPWM 83

  Fly    88 AE-DMFVDVPPSSENDESTSPVEEEEEEDDEVDSSSMTVDCELGTRNSTHFAPLTKFNPTFYRRS 151
            .| .:..|.....||.|.::      ::|:..:.|..||..|...:.|..|:           .|
Human    84 MEKKLSKDWESRWENKELST------KKDNYDEDSPQTVIIEKVVKQSYEFS-----------NS 131

  Fly   152 PRITQFIE----LYKQQTCLWDPADESYRDKEKRANAYEELLEQLKATVNLHLTAYKLKKCITSL 212
            .:..::||    .:..|...:.||..:.|:.....:.|:         .|:..:.:..|..:   
Human   132 KKNLEYIEKLEGKHGSQVDHFRPAILTSRESPTADSVYK---------YNIFRSTFHSKSTL--- 184

  Fly   213 HAQYASISRQKKTQKLTKVPLYYHGKYSFLAERGSLEDADSDDVDGDGKIKLV--------FTEE 269
             ::...||.:..:.           ||..|.:....:....::....|| ||:        |::.
Human   185 -SEPQKISAEGNSH-----------KYDILKKNLPKKSVIKNEKVNGGK-KLLNSNKSGAAFSQG 236

  Fly   270 NQLTTQFIDLYSKFPQ------LYDPAHKHFCNLNVRKSSLIEITDLLTSEFSLGLVTHYDVYDS 328
            ..||         .||      :|..:.   |.....|.|::.                      
Human   237 KSLT---------LPQTCNREKIYTCSE---CGKAFGKQSILN---------------------- 267

  Fly   329 IQSMRQWYSRRIKTLTDVQCVGLSLAEKQYIERCNSFMPTKSFRQKL-------------KCEVC 380
                |.|   ||.|           .||.|  .|.....|.|....|             ||..|
Human   268 ----RHW---RIHT-----------GEKPY--ECRECGKTFSHGSSLTRHLISHSGEKPYKCIEC 312

  Fly   381 EHSFSTDHALQAHQFRDHKMGDGGWFRCTLCELNFDRKCHLQQHSQRVH-MDKSFVCEICSRSFA 444
            ..:||...:|..||  ....|:.. :.|..|..:|.|..||.:| .|:| .:|.:.|.||.::|.
Human   313 GKAFSHVSSLTNHQ--STHTGEKP-YECMNCGKSFSRVSHLIEH-LRIHTQEKLYECRICGKAFI 373

  Fly   445 FGNQLAIHKRTHDEKHVAKPFVCEFCGKCFKQKIQMTTHV------------------------- 484
            ..:.|..|::.|..:   ||:.|..|||.|.....:|.|.                         
Human   374 HRSSLIHHQKIHTGE---KPYECRECGKAFCCSSHLTRHQRIHTMEKQYECNKCLKVFSSLSFLV 435

  Fly   485 --TAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANALVKHRHIHK-E 546
              .::||:.:.|:|..|.|.|.....|..|::.|:.::...|.:|.|||::.::|::|..||. |
Human   436 QHQSIHTEEKPFECQKCRKSFNQLESLNMHLRNHIRLKPYECSICGKAFSHRSSLLQHHRIHTGE 500

  Fly   547 KTLQCSLCTTRFSERVSLGVHMR 569
            |..:|..|...||...:|.||.|
Human   501 KPYECIKCGKTFSCSSNLTVHQR 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 13/88 (15%)
GT1 276..>341 CDD:304916 9/70 (13%)
C2H2 Zn finger 377..398 CDD:275368 7/20 (35%)
C2H2 Zn finger 408..429 CDD:275368 8/20 (40%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)
C2H2 Zn finger 467..488 CDD:275368 7/47 (15%)
C2H2 Zn finger 496..516 CDD:275368 6/19 (32%)
C2H2 Zn finger 524..544 CDD:275368 7/19 (37%)
C2H2 Zn finger 551..572 CDD:275368 8/19 (42%)
ZNF181XP_016882229.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.