DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and CG1529

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster


Alignment Length:225 Identity:62/225 - (27%)
Similarity:95/225 - (42%) Gaps:24/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 RQKLKCEVCEHSFSTDHALQAHQFRDHKMGDGGWFRCTLCELNFDRKCHLQQHSQRVHMD----- 431
            |..|.|:.|.........|:|| .|....|....|.|..|:.:|.|...|:.|.:..|..     
  Fly   166 RAGLACDQCGKQVYKLPYLEAH-IRSVHQGYSKPFLCRSCDKSFTRYEQLRSHMRNAHPQLEQLQ 229

  Fly   432 ---KSFVCEICSRSFAFGNQLAIHKRTHDEKHVAKPFVCEFCGKCFKQKIQMTTHVTAVHTKIRA 493
               :..:||:|:|.::..|.|..|.:.|.::   |..|||.||.....:.::.||:...:.....
  Fly   230 QELRDLICELCNRQYSTKNALGEHLKRHAQR---KEHVCEHCGVAKVTRTELLTHLRTHNPTWER 291

  Fly   494 FKCDMCPKDFLTKRDLKDHVK-AHLNIRDKVCEVCQKAFTNANALVKHRHIHKEKT--------- 548
            |||:.||:.|..|..:..||: .|...|...|..|:|.|....:.|:|..:|.|.|         
  Fly   292 FKCEQCPQLFRHKSAISRHVRVVHEGQRRFQCGHCEKKFGTHASQVRHERLHTESTGSGEAAEEW 356

  Fly   549 -LQCSLCTTRFSERVSLGVHMRRTHKILKS 577
             ..|..|......|.:|.:|:|| |:..|:
  Fly   357 PFACIHCQKPCVSRQTLELHLRR-HRARKT 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916
C2H2 Zn finger 377..398 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..429 CDD:275368 6/20 (30%)
C2H2 Zn finger 436..456 CDD:275368 7/19 (37%)
C2H2 Zn finger 467..488 CDD:275368 6/20 (30%)
C2H2 Zn finger 496..516 CDD:275368 7/20 (35%)
C2H2 Zn finger 524..544 CDD:275368 6/19 (32%)
C2H2 Zn finger 551..572 CDD:275368 7/20 (35%)
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071
C2H2 Zn finger 171..192 CDD:275368 6/21 (29%)
zf-C2H2_2 201..>257 CDD:289522 14/55 (25%)
C2H2 Zn finger 201..222 CDD:275368 6/20 (30%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 265..285 CDD:275368 6/19 (32%)
zf-C2H2_8 268..349 CDD:292531 24/80 (30%)
C2H2 Zn finger 294..315 CDD:275368 7/20 (35%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
C2H2 Zn finger 360..380 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.