DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and CG7101

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster


Alignment Length:315 Identity:69/315 - (21%)
Similarity:98/315 - (31%) Gaps:103/315 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 LAEKQYIERCNSFMPTKSFRQKLKCEVCEHSFSTDHALQAHQFRDHKMGD--------------- 402
            ||.|::.::|     :...|:...|..|...|..:..|:.|:.|.|..|.               
  Fly    45 LAAKRHEQQC-----SVRVRRLFVCPHCLTLFGEEARLERHRERKHNDGQFLCLQCGKKYASATF 104

  Fly   403 -----GGW------FRCTLCELN------FDRKCHLQQHSQRVH--------------------- 429
                 ..|      |.|.:|..|      |.....||:|::.||                     
  Fly   105 LYRHVASWHGQQSLFYCDMCTDNCNDVKTFSGMLELQEHAEEVHRLRTLKSTASDADSQVDEMED 169

  Fly   430 ----------------------------MDKS----------FVCEICSRSFAFGNQLAIHKRTH 456
                                        :||.          |||..|:..|.....|..|.   
  Fly   170 LEMLEENIENILPSIDWDDDLTFGWPTDLDKESCIVNAKPSVFVCPFCANGFPGSLSLVRHL--- 231

  Fly   457 DEKHVAKPFVCEFCGKCFKQKIQMTTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHVKA-HLNIR 520
            ::.|......|.:|||....:..:.:|:..||..:|...|.:|..||.|...||.||.: ||:.|
  Fly   232 EQVHERSALDCCYCGKSHGSREALRSHLQRVHILLRGHVCGICQADFATADHLKKHVNSLHLDHR 296

  Fly   521 DKVCEVCQKAFTNANALVKHRHI---HKEKTLQCSLCTTRFSERVSLGVHMRRTH 572
            ..:|..|.|.||....|..|...   |...|..|..|...|...:.|..|:...|
  Fly   297 PHLCPTCGKRFTQRCHLTDHIKTDRGHGHGTYTCEFCVRPFFRAIDLERHVCEEH 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916
C2H2 Zn finger 377..398 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..429 CDD:275368 7/26 (27%)
C2H2 Zn finger 436..456 CDD:275368 5/19 (26%)
C2H2 Zn finger 467..488 CDD:275368 5/20 (25%)
C2H2 Zn finger 496..516 CDD:275368 9/20 (45%)
C2H2 Zn finger 524..544 CDD:275368 7/22 (32%)
C2H2 Zn finger 551..572 CDD:275368 5/20 (25%)
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 13/55 (24%)
C2H2 Zn finger 242..263 CDD:275368 5/20 (25%)
C2H2 Zn finger 271..292 CDD:275368 9/20 (45%)
C2H2 Zn finger 300..319 CDD:275368 7/18 (39%)
C2H2 Zn finger 330..347 CDD:275368 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440038
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.