DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and CG43347

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001138185.2 Gene:CG43347 / 31991 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster


Alignment Length:571 Identity:119/571 - (20%)
Similarity:215/571 - (37%) Gaps:128/571 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 VPPSSENDESTSP------VEEEEEEDDEVDSSSMTVDCELGTRNSTHFAPLTKFNPTFYRRSPR 153
            :||:|.::....|      .:|::::|:|:|..::.                         |..:
  Fly   874 MPPNSYDEHDDEPGAGLGGNDEDDDDDEELDEEALA-------------------------REMK 913

  Fly   154 ITQ-FIELYKQQTCLWDPADESYRDKEKRANAYEELLEQLK-----ATVNLHLTAYKLKKCITSL 212
            :.| |:|...:.    |.|..|::...:.:.|::..|..|:     .|..:.|..:..::.:.:|
  Fly   914 MEQNFVEEEDEH----DIAFRSHQSCRECSIAHDHKLCPLRNACGNVTDAVDLGEWIERRNLEAL 974

  Fly   213 HAQYASISRQKKTQKLTKVPLYYHGKYSFLAERGSLEDADSDDVDGDGKIKLVFTEENQLTT--- 274
            ....|...||.|...         |:...  |...:||.:..|:|.|...:|...|...|.|   
  Fly   975 AKLKADAQRQAKRAS---------GRQRH--EDDDMEDMEDMDMDMDESSQLSELETKPLITFAE 1028

  Fly   275 -----QF-----------------IDLYSKF-PQLYDPAHK-------------HFCNLNVRKSS 303
                 :|                 :..::|. |.:..|...             ..|.....||.
  Fly  1029 ASVPAEFELHNVEPNVTGVFARTEVRAFTKLGPLIGQPVQTGEVREGSDMKWIFEMCEAGADKSY 1093

  Fly   304 LIEITDLLTSEFSLGLVTHYDVYDS-----IQSMRQWYSRRIKTLTDVQCVGLSLAEKQYIERCN 363
            |:...:...|.: |..|.....|:.     :...||.|....:.|.:    |:.|.  .:.:.||
  Fly  1094 LLCCDNPNASNW-LRFVRPAPSYEERNVNLVSIDRQAYFVSCRDLRN----GMELL--YWSDDCN 1151

  Fly   364 SFMPTKSFRQKLKCEVCEHSFSTDHAL--QAH--QFRDHKMG-DGGWFRCTLCELNFDRKCHLQQ 423
            : |..|...:|..|..|...|  :|.|  :.|  .|.|..|. ....:.|.:|......|.::.:
  Fly  1152 T-MWRKKHTEKTNCGGCNLKF--EHPLYYRTHCSVFHDPSMSLTIRKYHCKVCGEPVLGKDNIMK 1213

  Fly   424 HSQRVHMDK-SFVCEICSRSFAFGNQLAIHKRTH---DEKHVAKPFVCEFCGKCFKQKIQMTTHV 484
            |:...|..| ::.|:.||:.|...|.|.:| ||:   ...:.::| ||:|||:.|.|..::..|:
  Fly  1214 HAAEKHDGKGAYQCQFCSKFFLRLNYLEMH-RTYGCASNPNRSRP-VCDFCGRKFCQPQKLKAHI 1276

  Fly   485 TAVHTK----IRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKV---CEVCQKAFTNANALVKHRH 542
            ..:|:.    :|.|:|.:|.|...::..|:.|.| .::.|:..   |..|||.|.|.:.|..|..
  Fly  1277 KRMHSDMAEVLRDFQCKLCSKLLGSRAALQRHSK-EVHSRNSTVVSCPRCQKLFQNRSNLKIHML 1340

  Fly   543 IHK-EKTLQCS--LCTTRFSERVSLGVHMRRTHKILKSSLSSSDALFTKTF 590
            .|. .:..:|:  .|...|:.:..|..|.::.|...:..:...:.....||
  Fly  1341 THSGVRPFKCAEPECNAAFTTKQCLQFHYKKVHNYTQEQMPKIERSVAYTF 1391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 16/89 (18%)
GT1 276..>341 CDD:304916 15/100 (15%)
C2H2 Zn finger 377..398 CDD:275368 7/24 (29%)
C2H2 Zn finger 408..429 CDD:275368 4/20 (20%)
C2H2 Zn finger 436..456 CDD:275368 8/19 (42%)
C2H2 Zn finger 467..488 CDD:275368 7/20 (35%)
C2H2 Zn finger 496..516 CDD:275368 6/19 (32%)
C2H2 Zn finger 524..544 CDD:275368 8/19 (42%)
C2H2 Zn finger 551..572 CDD:275368 5/22 (23%)
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 22/71 (31%)
C2H2 Zn finger 1198..1219 CDD:275368 4/20 (20%)
C2H2 Zn finger 1227..1255 CDD:275368 9/28 (32%)
C2H2 Zn finger 1259..1280 CDD:275368 7/20 (35%)
C2H2 Zn finger 1292..1313 CDD:275368 6/21 (29%)
C2H2 Zn finger 1322..1342 CDD:275368 8/19 (42%)
zf-H2C2_2 1334..1361 CDD:290200 6/26 (23%)
C2H2 Zn finger 1350..1373 CDD:275368 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.