DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and CG2120

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:362 Identity:82/362 - (22%)
Similarity:133/362 - (36%) Gaps:99/362 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 SLEDADSDDVDGDGKIKLVFTEENQLTTQFIDLY-SKFP---QLYDPAHKHFCNLNVRKSSLIEI 307
            :|.|.|..:.|       |..|:.||..|..||. .:.|   :|.:|..::            ::
  Fly    14 TLADDDLGNYD-------VCLEDLQLFAQLEDLSGERLPMEMELLNPGSEY------------DL 59

  Fly   308 TDLLTSEFSLGLVTHYDVYDSIQSMRQWYSRRIKTLTDVQCVGLSLAEKQYIERCNSFMPTKSFR 372
            .:|:.........|.:...|..:..|...::|.:|           ..|.:              
  Fly    60 LELVNGALQQRNTTEHKPTDMCKPKRTPTTKRHRT-----------TGKDH-------------- 99

  Fly   373 QKLKCEVCEHSFSTDHALQAHQFRDHKM--GDGGWFRCTLCELNFDRKCHLQQHSQRVHMDKSFV 435
               .|::|:..||     :|:..|.|||  .|.....|..|...|.:...|:.|:.....::...
  Fly   100 ---TCDICDRRFS-----EAYNLRIHKMTHTDEKPHVCVECGKGFRQLNKLRIHAVTHTAERPHK 156

  Fly   436 CEICSRSFAFGNQLAIHKRTHDEKHVAKPFVC--EFCGKCFKQKIQMTTHVTAVHTKIR------ 492
            |:||.:.|.:.|.|.:|:|.|..:   ||:.|  ..|...|.     :.|...:|||:|      
  Fly   157 CDICGKGFRYANYLTVHRRLHTGE---KPYPCLATDCHLSFH-----SIHARRIHTKLRHAAQTD 213

  Fly   493 ------------------AFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVC--EVCQKAFTNANAL 537
                              :|.|.:|.:....:..|..|:|.|.|.||..|  ..|.|.|.:|:.|
  Fly   214 PDPEHPLAEQEQRDTSALSFTCPVCSRVLTDQCYLSIHLKRHYNQRDFPCPQPECGKRFFSASEL 278

  Fly   538 VKHRHIH-KEKTLQCSLCTTRF----SERVSLGVHMR 569
            ..|:..| :::...|.||..||    :.:..|.||.|
  Fly   279 KHHQIAHTQQRPFACPLCPARFLRKSNHKQHLKVHER 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916 10/68 (15%)
C2H2 Zn finger 377..398 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..429 CDD:275368 5/20 (25%)
C2H2 Zn finger 436..456 CDD:275368 8/19 (42%)
C2H2 Zn finger 467..488 CDD:275368 4/22 (18%)
C2H2 Zn finger 496..516 CDD:275368 5/19 (26%)
C2H2 Zn finger 524..544 CDD:275368 7/21 (33%)
C2H2 Zn finger 551..572 CDD:275368 9/23 (39%)
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 9/24 (38%)
zf-H2C2_2 113..138 CDD:290200 8/24 (33%)
C2H2 Zn finger 129..149 CDD:275368 5/19 (26%)
zf-H2C2_2 142..166 CDD:290200 6/23 (26%)
COG5048 151..>264 CDD:227381 29/120 (24%)
C2H2 Zn finger 157..177 CDD:275368 8/19 (42%)
C2H2 Zn finger 185..206 CDD:275368 6/25 (24%)
C2H2 Zn finger 235..255 CDD:275368 5/19 (26%)
C2H2 Zn finger 263..285 CDD:275368 7/21 (33%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.