DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and CG12219

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_572312.1 Gene:CG12219 / 31572 FlyBaseID:FBgn0043796 Length:562 Species:Drosophila melanogaster


Alignment Length:529 Identity:105/529 - (19%)
Similarity:153/529 - (28%) Gaps:192/529 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EHFVLACAHQND----C-YVEMEFKRWREFIVHVK-----------EHLEANPSMQQELTTSEVI 62
            ||.   ..|..|    | |.||.|:.......|||           |..:|..|.|...|     
  Fly   155 EHI---ATHTGDRPIACPYCEMAFRCRSNMYTHVKSKHTTQWLKAREERDAAKSNQNHTT----- 211

  Fly    63 SSAKCEEEVSPAKVFIVEEPPENCLAEDMFVDVPPSSENDESTSPVEEEEEEDDEVDSSSMTVDC 127
                 .||.:|| |.:....|...||.      .|:|    |.||............:||.|...
  Fly   212 -----PEETAPA-VLVPVPAPAPALAS------APAS----SASPGNTVNPAATATPASSATPTT 260

  Fly   128 ELGTRNSTHFAPLTKFNPTFYRRSPRITQFIELYKQQTCLWDPADESYRDKEKRANAYEELLEQL 192
            .|..      |||.         ||...|.:.|                         ..:..|.
  Fly   261 NLAA------APLP---------SPPTVQQLPL-------------------------SVIKSQP 285

  Fly   193 KATVNLHLTAYKLKKCITSLHAQYASISRQKKTQKLTKVPLYYHGKYSFLAERGSLEDADSDDVD 257
            ...:||.:|     |...|......:.|.::||....||.              ..|.:|..|.|
  Fly   286 SEAMNLTIT-----KTPPSGSRGSRNRSSRRKTHSPKKVQ--------------HTEGSDVSDED 331

  Fly   258 GDGK----IKLVFTEENQLTTQFI---DLYSKFPQLYDPAHKHFCNLNVRKSSLIEITDLLTSEF 315
            ...|    .:|:....|.:....:   .|....|...|...:..|      :||::         
  Fly   332 SPQKRLKENELILANYNAVAAAVVAAASLTGNPPGQPDSLQQRLC------ASLLQ--------- 381

  Fly   316 SLGLVTHYDVYDSIQSMRQWYSRRIKTLTDVQCVGLSLAEKQYIERCNSFMPTKSFRQKLKCEVC 380
                         .|...|.::....|......||.|.|...                       
  Fly   382 -------------QQHQEQLFAVMSATAAAAAAVGTSSATTT----------------------- 410

  Fly   381 EHSFSTDHALQAHQFRDHKMGDGGWFRCTLCELNFDRK--CHLQQ--HSQRVHMDKSFVCEICSR 441
              :.:|...:.||.:.:|...:            .|::  ..||.  |:..|    |.:|..|..
  Fly   411 --TTTTTGTMMAHPYGNHPPSE------------TDKRPAAPLQAVIHAAPV----SIICPNCGE 457

  Fly   442 SFAFGNQLAIHKRTHDEKHVAKP-FVCEFCGKCFKQKIQMTTHVTAVHTKIRAFKCDMCPKDFLT 505
                     :..:.|  :.::|| :.|:.|||.||.|..:..|. |.||.::...|..||.:|.:
  Fly   458 ---------LPGQNH--RCLSKPKYACDVCGKSFKMKRYLEEHF-ATHTGVKLHTCAFCPTEFRS 510

  Fly   506 KRDLKDHVK 514
            |.::..|.|
  Fly   511 KSNMYHHTK 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 12/84 (14%)
GT1 276..>341 CDD:304916 8/67 (12%)
C2H2 Zn finger 377..398 CDD:275368 3/20 (15%)
C2H2 Zn finger 408..429 CDD:275368 4/24 (17%)
C2H2 Zn finger 436..456 CDD:275368 2/19 (11%)
C2H2 Zn finger 467..488 CDD:275368 9/20 (45%)
C2H2 Zn finger 496..516 CDD:275368 7/19 (37%)
C2H2 Zn finger 524..544 CDD:275368
C2H2 Zn finger 551..572 CDD:275368
CG12219NP_572312.1 zf-AD 2..94 CDD:285071
C2H2 Zn finger 140..160 CDD:275368 2/7 (29%)
COG4049 149..204 CDD:226535 14/51 (27%)
C2H2 Zn finger 168..186 CDD:275368 6/17 (35%)
C2H2 Zn finger 473..493 CDD:275370 9/20 (45%)
C2H2 Zn finger 501..522 CDD:275370 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439988
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.