DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and mld

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster


Alignment Length:202 Identity:60/202 - (29%)
Similarity:84/202 - (41%) Gaps:22/202 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 CTLCELNFDRKCHLQQHSQRVH---MDKSFVCEICSRSFAFGNQLAIHKRTHDEKHVAKPFVCEF 469
            |..||..|..:..|::|.|..|   ....:||.||.|.:.....|..|..:||.:  .:|:.|..
  Fly  1725 CLYCEERFTNEISLKKHHQLAHGALTTMPYVCTICKRGYRMRTALHRHMESHDVE--GRPYECNI 1787

  Fly   470 CGKCFKQKIQMTTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNA 534
            |...|.:..|:|.|...||...:...||.|.|.|.|:..||.|:|.|..:..: |:.|.:.|...
  Fly  1788 CRVRFPRPSQLTLHKITVHLLSKPHTCDECGKQFGTESALKTHIKFHGELGYQ-CDGCDRTFEYL 1851

  Fly   535 NALVKHRHIHKEKTLQCSLCTTRFSERVSLGVHMRRTHKIL---------------KSSLSSSDA 584
            ..|.|||..|.|...:|..|.:.|....:...|| :||..|               .:|.:|||.
  Fly  1852 KELRKHRRTHSEMFYKCKFCPSSFMRFTNFRAHM-KTHLPLGVFRNEDAASKSPSNNNSHASSDK 1915

  Fly   585 LFTKTFP 591
            |.....|
  Fly  1916 LENPATP 1922

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916
C2H2 Zn finger 377..398 CDD:275368
C2H2 Zn finger 408..429 CDD:275368 7/20 (35%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)
C2H2 Zn finger 467..488 CDD:275368 6/20 (30%)
C2H2 Zn finger 496..516 CDD:275368 10/19 (53%)
C2H2 Zn finger 524..544 CDD:275368 7/19 (37%)
C2H2 Zn finger 551..572 CDD:275368 5/20 (25%)
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368 7/20 (35%)
C2H2 Zn finger 1756..1776 CDD:275368 6/19 (32%)
C2H2 Zn finger 1785..1806 CDD:275368 6/20 (30%)
C2H2 Zn finger 1814..1834 CDD:275368 10/19 (53%)
zf-C2H2 1839..1861 CDD:278523 7/22 (32%)
C2H2 Zn finger 1841..1861 CDD:275368 7/19 (37%)
C2H2 Zn finger 1868..1888 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439976
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.