DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and ZNF48

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_001201835.1 Gene:ZNF48 / 197407 HGNCID:13114 Length:618 Species:Homo sapiens


Alignment Length:268 Identity:72/268 - (26%)
Similarity:99/268 - (36%) Gaps:69/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 KSFRQ---------------KLKCEVCEHSFSTDHALQAHQFRDHKMGDGGWFR----------- 407
            |||||               ..||.||...|....|...|| |.|. |:..:..           
Human   119 KSFRQMSDLVKHQRTHTGEKPYKCGVCGKGFGDSSARIKHQ-RTHS-GEKPYRARPPAQGPPKIP 181

  Fly   408 ------------CTLCELNFDRKCHLQQHSQRVHM-DKSFVCEICSRSFAFGNQLAIHKRTH--- 456
                        |..|..:|.:...|.:| ||.|. :|.:.|.||.:.|...:....|:|||   
Human   182 RSRIPAGERPTICGECGKSFRQSSDLVKH-QRTHTGEKPYKCGICGKGFGDSSARIKHQRTHRGE 245

  Fly   457 ---------------------DEKHVAKPFVCEFCGKCFKQKIQMTTHVTAVHTKIRAFKCDMCP 500
                                 ..|...||::|..|||.|.....:.:|..: |...:.|.||:|.
Human   246 QPPRPVVPRRQPSRAATAATQGPKAQDKPYICTDCGKRFVLSCSLLSHQRS-HLGPKPFGCDVCG 309

  Fly   501 KDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANALVKHRHIHK-EKTLQCSLCTTRFSERVSL 564
            |:|....||..|::.|...:..:|..|.|.|.:::|.|||...|. |:...|..|...||...:|
Human   310 KEFARGSDLVKHLRVHTGEKPYLCPECGKGFADSSARVKHLRTHSGERPHACPECDRTFSLSSTL 374

  Fly   565 GVHMRRTH 572
            ..| |.||
Human   375 LRH-RLTH 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916
C2H2 Zn finger 377..398 CDD:275368 8/20 (40%)
C2H2 Zn finger 408..429 CDD:275368 7/20 (35%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)
C2H2 Zn finger 467..488 CDD:275368 6/20 (30%)
C2H2 Zn finger 496..516 CDD:275368 8/19 (42%)
C2H2 Zn finger 524..544 CDD:275368 8/19 (42%)
C2H2 Zn finger 551..572 CDD:275368 7/20 (35%)
ZNF48NP_001201835.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..109
zf-C2H2 113..134 CDD:278523 5/14 (36%)
COG5048 114..499 CDD:227381 72/268 (27%)
C2H2 Zn finger 114..134 CDD:275368 5/14 (36%)
zf-H2C2_2 126..149 CDD:290200 4/22 (18%)
C2H2 Zn finger 142..162 CDD:275368 8/20 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..189 5/33 (15%)
C2H2 Zn finger 194..214 CDD:275368 7/20 (35%)
zf-C2H2 194..214 CDD:278523 7/20 (35%)
zf-H2C2_2 206..229 CDD:290200 9/23 (39%)
C2H2 Zn finger 222..242 CDD:275368 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..271 5/35 (14%)
C2H2 Zn finger 277..297 CDD:275368 6/20 (30%)
C2H2 Zn finger 305..325 CDD:275368 8/19 (42%)
zf-H2C2_2 317..341 CDD:290200 7/23 (30%)
C2H2 Zn finger 333..353 CDD:275368 8/19 (42%)
zf-H2C2_2 348..369 CDD:290200 6/20 (30%)
C2H2 Zn finger 361..381 CDD:275368 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..457
zf-C2H2 451..473 CDD:278523
C2H2 Zn finger 453..473 CDD:275368
zf-H2C2_2 465..489 CDD:290200
C2H2 Zn finger 481..501 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..540
COG5048 524..>591 CDD:227381
zf-C2H2 543..565 CDD:278523
C2H2 Zn finger 545..565 CDD:275368
zf-H2C2_2 557..580 CDD:290200
C2H2 Zn finger 573..593 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.