DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment az2 and mnm-2

DIOPT Version :9

Sequence 1:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster
Sequence 2:NP_509256.2 Gene:mnm-2 / 182489 WormBaseID:WBGene00003380 Length:249 Species:Caenorhabditis elegans


Alignment Length:107 Identity:37/107 - (34%)
Similarity:60/107 - (56%) Gaps:6/107 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 LNFDRKCHLQQHSQRVHMDKSFVCEICSRSFAFGNQLAIHKRTHDEKHVAKPFVCEFCGKCFKQK 477
            ||..|..:: .|||:.:: |.:.|::|.::|:..|.|..|||.|..:   |||.||.||:.|:|.
 Worm   149 LNNKRASYV-DHSQKGNL-KKYRCDVCDKTFSRSNTLITHKRIHTGE---KPFKCEHCGRAFRQP 208

  Fly   478 IQMTTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNI 519
            ..:|.| ...||.::.:.|.:|.|.|....:|..|::.|.|:
 Worm   209 GNLTRH-RLTHTTVKPYVCGLCDKAFNRASNLHTHMRTHTNV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916
C2H2 Zn finger 377..398 CDD:275368
C2H2 Zn finger 408..429 CDD:275368 6/15 (40%)
C2H2 Zn finger 436..456 CDD:275368 8/19 (42%)
C2H2 Zn finger 467..488 CDD:275368 8/20 (40%)
C2H2 Zn finger 496..516 CDD:275368 6/19 (32%)
C2H2 Zn finger 524..544 CDD:275368
C2H2 Zn finger 551..572 CDD:275368
mnm-2NP_509256.2 zf-C2H2 168..190 CDD:278523 8/21 (38%)
C2H2 Zn finger 170..190 CDD:275368 8/19 (42%)
zf-H2C2_2 183..207 CDD:290200 13/26 (50%)
C2H2 Zn finger 198..218 CDD:275368 8/20 (40%)
zf-H2C2_2 210..235 CDD:290200 8/25 (32%)
zf-C2H2 224..246 CDD:278523 6/21 (29%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I3519
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.