DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment az2 and ZNF688

DIOPT Version :9

Sequence 1:	NP_610289.2	Gene:	az2 / 35682	FlyBaseID:	FBgn0025185	Length:	593	Species:	Drosophila melanogaster
Sequence 2:	XP_024305933.1	Gene:	ZNF688 / 146542	HGNCID:	30489	Length:	384	Species:	Homo sapiens

Alignment Length:	61	Identity:	22/61 - (36%)
Similarity:	29/61 - (47%)	Gaps:	8/61 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   423 QHSQRVHMDKSFVCEICSRSFAFGNQLAIHKRTHDEKHVAKPFVCEFCGKCFKQKIQMTTH 483
            |..||.|     ||..|.|.|.:.:.|..|:|.|..:   :||.|..||..||:|..:..|
Human   285 QAGQRRH-----VCTDCGRRFTYPSLLVSHRRMHSGE---RPFPCPECGMRFKRKFAVEAH 337

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
az2	NP_610289.2	MADF_DNA_bdg	157..242	CDD:287510
		GT1	276..>341	CDD:304916
		C2H2 Zn finger	377..398	CDD:275368
		C2H2 Zn finger	408..429	CDD:275368	3/5 (60%)
		C2H2 Zn finger	436..456	CDD:275368	7/19 (37%)
		C2H2 Zn finger	467..488	CDD:275368	7/17 (41%)
		C2H2 Zn finger	496..516	CDD:275368
		C2H2 Zn finger	524..544	CDD:275368
		C2H2 Zn finger	551..572	CDD:275368
ZNF688	XP_024305933.1	KRAB	171..212	CDD:307490
		Zn-ribbon_8	<251..>318	CDD:321291	13/40 (33%)
		zf-C2H2	291..313	CDD:306579	9/26 (35%)
		C2H2 Zn finger	293..313	CDD:275368	7/19 (37%)
		zf-H2C2_2	306..330	CDD:316026	10/26 (38%)
		C2H2 Zn finger	321..341	CDD:275368	7/17 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165142451
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930